BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0008 (564 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 27 2.5 SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc... 26 4.4 SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pom... 25 7.7 >SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1096 Score = 26.6 bits (56), Expect = 2.5 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -1 Query: 159 NPFHLYFILKVFHSYCCNFIKKTCIFYFVSCFIYIFSV 46 +PF+L+ + V C +F+ +C F+S + SV Sbjct: 201 HPFYLFQAVSVLIWLCDSFVFYSCCIVFISSYSIFLSV 238 >SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1463 Score = 25.8 bits (54), Expect = 4.4 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -3 Query: 307 YYSSYKA*NVYIIFCYILLCTGTSGLTI 224 Y++ +KA ++++IF Y L G G+ + Sbjct: 891 YWTYFKACSLFLIFLYFLFIIGGIGMNV 918 >SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1375 Score = 25.0 bits (52), Expect = 7.7 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -3 Query: 103 HKKNMHILFCVVFYIYFFCSVIYFSL*LFKYEKK 2 H ++ + + ++ IYFF + YFSL K+E + Sbjct: 684 HFIHLRVWYVLLHKIYFFIASAYFSLKNEKFENE 717 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,349,419 Number of Sequences: 5004 Number of extensions: 49365 Number of successful extensions: 116 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 238029836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -