BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0008 (564 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47210.1 68415.m05896 myb family transcription factor contain... 29 2.8 At3g02290.2 68416.m00211 zinc finger (C3HC4-type RING finger) fa... 28 5.0 At3g02290.1 68416.m00210 zinc finger (C3HC4-type RING finger) fa... 28 5.0 >At2g47210.1 68415.m05896 myb family transcription factor contains Pfam profile: PF00249 myb DNA-binding domain Length = 441 Score = 28.7 bits (61), Expect = 2.8 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -1 Query: 492 KVVNRTLTSIESAGVNFTVRVPDRDVCSLHLFKYRPRLGLRTL*HNLQ 349 + + R +++ GVN +VP + VC HL + L L L LQ Sbjct: 324 RTIKRVEQTLQDLGVNLKPKVPTKTVCDEHLELRKEILTLLNLQKQLQ 371 >At3g02290.2 68416.m00211 zinc finger (C3HC4-type RING finger) family protein contains zinc finger motif, C3HC4 type (RING finger) Length = 231 Score = 27.9 bits (59), Expect = 5.0 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 478 DVDQYRKCRCELYRSSPGSRCLLASFVQI 392 D+D+Y +YR+ P RCL +F+ + Sbjct: 12 DIDEYMNPNSSVYRNCPCIRCLAHNFLNL 40 >At3g02290.1 68416.m00210 zinc finger (C3HC4-type RING finger) family protein contains zinc finger motif, C3HC4 type (RING finger) Length = 231 Score = 27.9 bits (59), Expect = 5.0 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 478 DVDQYRKCRCELYRSSPGSRCLLASFVQI 392 D+D+Y +YR+ P RCL +F+ + Sbjct: 12 DIDEYMNPNSSVYRNCPCIRCLAHNFLNL 40 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,584,448 Number of Sequences: 28952 Number of extensions: 230703 Number of successful extensions: 478 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 478 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1082538160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -