BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0007 (555 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 2.1 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 2.1 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 3.6 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 4.8 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 4.8 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 4.8 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 4.8 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 6.3 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 23.0 bits (47), Expect = 2.1 Identities = 8/36 (22%), Positives = 19/36 (52%) Frame = -2 Query: 455 FYQNPLEILKTCRVTHMTFLSQKLFLRVALKVHKQY 348 FY + +++ C + M+FL +L+ + + + Y Sbjct: 656 FYPDRKQVILKCNIQDMSFLFSQLYNALLILISTVY 691 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 23.0 bits (47), Expect = 2.1 Identities = 8/36 (22%), Positives = 19/36 (52%) Frame = -2 Query: 455 FYQNPLEILKTCRVTHMTFLSQKLFLRVALKVHKQY 348 FY + +++ C + M+FL +L+ + + + Y Sbjct: 746 FYPDRKQVILKCNIQDMSFLFSQLYNALLILISTVY 781 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.2 bits (45), Expect = 3.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 364 KYTSNT*KRQYYIKHYLIN 308 KY N ++ Y K+Y+IN Sbjct: 330 KYNYNNYNKKLYYKNYIIN 348 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.8 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -1 Query: 429 EDMSGNAYDVFKPETFLKSCPQ 364 +D SG + + PE + K C + Sbjct: 27 QDSSGRIFTICVPEIYSKECDE 48 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.8 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -1 Query: 429 EDMSGNAYDVFKPETFLKSCPQ 364 +D SG + + PE + K C + Sbjct: 27 QDSSGRIFTICVPEIYSKECDE 48 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.8 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -1 Query: 429 EDMSGNAYDVFKPETFLKSCPQ 364 +D SG + + PE + K C + Sbjct: 27 QDSSGRIFTICVPEIYSKECDE 48 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.8 bits (44), Expect = 4.8 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -2 Query: 80 SCAPVGTGRYYRPAYYCR 27 +C P R Y+PA+ C+ Sbjct: 407 ACCPGRVRRRYQPAFRCK 424 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 6.3 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 361 YTSNT*KRQYYIKHYLIN 308 Y +N ++ Y K+Y+IN Sbjct: 106 YNNNNYNKKLYYKNYIIN 123 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,561 Number of Sequences: 438 Number of extensions: 2969 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15949830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -