BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0005 (609 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1322.14c |vtc4||vacuolar transporter chaperone |Schizosaccha... 26 3.7 SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosacchar... 25 6.5 SPCC1450.14c |ero12||ER oxidoreductin Ero1b|Schizosaccharomyces ... 25 8.7 >SPCC1322.14c |vtc4||vacuolar transporter chaperone |Schizosaccharomyces pombe|chr 3|||Manual Length = 721 Score = 26.2 bits (55), Expect = 3.7 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 7 TSGSPRLAGNSAAGGSREK-ERETEYYLLSQNK*TMRNIKYKKY 135 T GSP + G+SAAGG+++ R+T Y + N T I K+ Sbjct: 174 TRGSP-IKGDSAAGGTQQNFVRQTTKYWVHPNNVTELKIYILKH 216 >SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosaccharomyces pombe|chr 1|||Manual Length = 859 Score = 25.4 bits (53), Expect = 6.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +3 Query: 183 DKDHLETNHINITLTNILL 239 +KD +ETNH+ T+TN+ L Sbjct: 23 NKDIVETNHLYPTITNLSL 41 >SPCC1450.14c |ero12||ER oxidoreductin Ero1b|Schizosaccharomyces pombe|chr 3|||Manual Length = 571 Score = 25.0 bits (52), Expect = 8.7 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -3 Query: 451 AWTISQPIWY*VVTGTHRHLQRKCVTHLEI*VLRSRYSYNGCPTLQ 314 AWT+ Q ++Y V++G H + THL L R G P LQ Sbjct: 249 AWTLEQRVFYRVLSGMHSSIS----THLCHGYLNQRNGVWG-PNLQ 289 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,574,713 Number of Sequences: 5004 Number of extensions: 52657 Number of successful extensions: 103 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 268287866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -