BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0002 (607 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57887| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_4910| Best HMM Match : HECT (HMM E-Value=5.8e-33) 29 2.9 SB_59742| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_43261| Best HMM Match : TSP_1 (HMM E-Value=0.0026) 27 8.9 SB_5403| Best HMM Match : TSP_1 (HMM E-Value=0) 27 8.9 SB_4637| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_57887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +1 Query: 142 ALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYIPW 258 ALIP +E R K+ S+PR R I +LN IP+ Sbjct: 18 ALIPGGVKSTLLENLREKVDKSIPRDRHSIAESLNQIPY 56 >SB_4910| Best HMM Match : HECT (HMM E-Value=5.8e-33) Length = 958 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +3 Query: 6 SEVFSFLWARFTSISNDKAPRNILVERGRLELPGP 110 SE FLWA +ND+ R + GR P P Sbjct: 459 SECIKFLWAALAQFTNDERSRFLRFVTGRRRPPAP 493 >SB_59742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 422 CRIHKCQTSKYPKTITLVCFDPCIQKS 342 C+ C TSK+ T T VC D I K+ Sbjct: 130 CKNGTCHTSKHDDTYTCVCDDGAIGKN 156 >SB_43261| Best HMM Match : TSP_1 (HMM E-Value=0.0026) Length = 649 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -1 Query: 367 ALTPVYRSQSCFDNLPNSLPSKLG*GVNFGDGSYGASR---ECSSK 239 A+ Y +Q C DN K G G N+ + Y + +CS+K Sbjct: 256 AIEETYNTQGCNDNCERCSDGKFGAGTNWSNFIYRVKKDWTDCSAK 301 >SB_5403| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 684 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -1 Query: 367 ALTPVYRSQSCFDNLPNSLPSKLG*GVNFGDGSYGASR---ECSSK 239 A+ Y +Q C DN K G G N+ + Y + +CS+K Sbjct: 115 AIEETYNTQGCNDNCERCSDGKFGAGTNWSNFIYRVKKDWTDCSAK 160 >SB_4637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 198 VRQRS*VALRYSSYFELHSLDAPYEPSPKLTPYPSFEGNELGKLSKQ 338 + R+ + YS YF L+ + SPK+T S + GKL K+ Sbjct: 5 IEDRTGPKISYSRYFSLNDIRHSPASSPKVTRAVSLQRISEGKLKKK 51 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,190,182 Number of Sequences: 59808 Number of extensions: 426570 Number of successful extensions: 1194 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1194 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -