BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2109 (550 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC947.01 |||AAA family ATPase, unknown biological role|Schizos... 27 1.4 SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Pa... 27 2.4 SPBC31F10.13c |hip1|hir1|hira protein Hip1|Schizosaccharomyces p... 27 2.4 SPBC3E7.05c |||conserved eukaryotic protein|Schizosaccharomyces ... 27 2.4 SPAC328.04 |||AAA family ATPase, unknown biological role|Schizos... 26 3.2 SPBC1604.18c |||vacuolar sorting protein |Schizosaccharomyces po... 25 5.6 SPAC3F10.04 |gsa1|gsh2|glutathione synthetase large subunit Gsa1... 25 7.3 >SPBC947.01 |||AAA family ATPase, unknown biological role|Schizosaccharomyces pombe|chr 2|||Manual Length = 660 Score = 27.5 bits (58), Expect = 1.4 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 206 PQNWPGLRGPDEPVSLFGDPGRGGSFL 126 P+ + GLR P + + LFG PG G + L Sbjct: 402 PELFQGLREPVQGMLLFGPPGTGKTML 428 >SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Par2|Schizosaccharomyces pombe|chr 1|||Manual Length = 627 Score = 26.6 bits (56), Expect = 2.4 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = +2 Query: 386 PTPSGRSPAXSSGTKGNDPRAXQQFXGVKKAXPPFLAXVPSPDGQKKAG 532 P P S + + ND + F V ++ PP+L P+P + AG Sbjct: 127 PEPKNDSVSSNIDEFPNDSISSASFLSVPQSTPPYLVSQPTPLNKFLAG 175 >SPBC31F10.13c |hip1|hir1|hira protein Hip1|Schizosaccharomyces pombe|chr 2|||Manual Length = 932 Score = 26.6 bits (56), Expect = 2.4 Identities = 14/51 (27%), Positives = 16/51 (31%) Frame = -1 Query: 466 PXKLLGCPGVISLGTRXXCWXPPGRGWF*AQPWGSAKXCFSRAAHSGXLAS 314 P LL C V CW P G F G+ C G + S Sbjct: 311 PRPLLSCQNVFQKSIGDVCWSPDGLSLFLCSYDGNVLVCTFEKEEFGDMVS 361 >SPBC3E7.05c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 26.6 bits (56), Expect = 2.4 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 91 TSFRAIHHVLQGRKXPPLPGSPKSETGSSGPRRPGQF 201 +S RA+ ++ K P+P PK E GSS +F Sbjct: 27 SSLRALPPDVKQNKTEPIPFVPKPEEGSSNKSNSSKF 63 >SPAC328.04 |||AAA family ATPase, unknown biological role|Schizosaccharomyces pombe|chr 1|||Manual Length = 741 Score = 26.2 bits (55), Expect = 3.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 206 PQNWPGLRGPDEPVSLFGDPGRGGSFL 126 P + GLR P + LFG PG G + L Sbjct: 482 PDLFQGLREPARGMLLFGPPGTGKTML 508 >SPBC1604.18c |||vacuolar sorting protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 449 Score = 25.4 bits (53), Expect = 5.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 155 QKVKPVHLDPEDQASSVEXQDLVGQK 232 Q P ++D ED+A E QDLV ++ Sbjct: 378 QTYNPQNIDLEDEAVEKEWQDLVAEE 403 >SPAC3F10.04 |gsa1|gsh2|glutathione synthetase large subunit Gsa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 498 Score = 25.0 bits (52), Expect = 7.3 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = -1 Query: 175 MNRFHFLGIRVEVXPFSPVVHGES 104 +NRFH + R+++ + ++H +S Sbjct: 247 LNRFHVISKRIDIAELNSLIHDKS 270 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,016,926 Number of Sequences: 5004 Number of extensions: 36736 Number of successful extensions: 61 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -