BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2109 (550 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 24 1.2 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 2.0 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 4.7 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.8 bits (49), Expect = 1.2 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +2 Query: 383 KPTPSGRSPAXSSGTKGNDPRAXQQFXGVKKAXPPFLAXVPSPDG 517 +P + +S SSG G P Q ++ PP + P P G Sbjct: 6 QPIITQQSQQPSSGAPGPQPSPHQSPQAPQRGSPPNPSQGPPPGG 50 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +1 Query: 88 LTSFRAIHHVLQGRKXPPLPGSPKSETGSSGP 183 L + ++ VL PP P P SSGP Sbjct: 322 LMEYCLVNIVLGDSDTPPKPAPPPPPPSSSGP 353 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.8 bits (44), Expect = 4.7 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 137 HLYPDPQKVKPVHLDPEDQAS 199 H+YP+P P + PE A+ Sbjct: 452 HIYPNPDVFDPDNFLPEKTAN 472 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,921 Number of Sequences: 438 Number of extensions: 3211 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -