BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2108 (600 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 25 0.49 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 24 1.1 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 25.0 bits (52), Expect = 0.49 Identities = 15/71 (21%), Positives = 31/71 (43%), Gaps = 1/71 (1%) Frame = -1 Query: 534 NSYRTIQLLYESTSIKAXNVTFGQ*LVNQKNELLTLYSIXSHKTLXNDILD-K*QVNYXP 358 NS R + +SI+ + ++ + + Y +H + N + + + +NY P Sbjct: 275 NSLRAADIQPTLSSIRHPESNPSERVMRELGRIFRAYCRENHASWVNHLSNIEDCLNYVP 334 Query: 357 LFNAGFEPYSL 325 + GF PY + Sbjct: 335 HISTGFSPYEI 345 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/18 (55%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Frame = +3 Query: 234 VYYQR-WQSVHLDKKMLL 284 VY R WQ +HL+KK +L Sbjct: 531 VYNHRPWQQLHLNKKQIL 548 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,383 Number of Sequences: 336 Number of extensions: 2255 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -