BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brS-2108
(600 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 25 1.9
DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 23 7.5
>AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione
S-transferase D6 protein.
Length = 222
Score = 25.0 bits (52), Expect = 1.9
Identities = 11/30 (36%), Positives = 16/30 (53%)
Frame = +2
Query: 47 KRDEYEEAYCKFSAYRYIVHTVSSDND*VL 136
KRD Y+ + K + YI V +D D V+
Sbjct: 38 KRDHYKPEFLKLNPQHYIPTLVDADGDVVV 67
>DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain
protein protein.
Length = 103
Score = 23.0 bits (47), Expect = 7.5
Identities = 7/10 (70%), Positives = 7/10 (70%)
Frame = +1
Query: 250 GNLCIWTKKC 279
G CIW KKC
Sbjct: 84 GGSCIWAKKC 93
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 517,326
Number of Sequences: 2352
Number of extensions: 8249
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 58029966
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -