BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2106 (550 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0LPV9 Cluster: Na-Ca exchanger/integrin-beta4 precurso... 32 7.6 UniRef50_A0ZFZ3 Cluster: Helicase domain protein; n=3; Bacteria|... 32 7.6 >UniRef50_Q0LPV9 Cluster: Na-Ca exchanger/integrin-beta4 precursor; n=1; Herpetosiphon aurantiacus ATCC 23779|Rep: Na-Ca exchanger/integrin-beta4 precursor - Herpetosiphon aurantiacus ATCC 23779 Length = 3417 Score = 32.3 bits (70), Expect = 7.6 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 321 WTSSRPTGVKWLPESIGISNANAVT 247 W + PTG+ ++P S ISNAN VT Sbjct: 1879 WVDTIPTGMSYVPGSAQISNANGVT 1903 >UniRef50_A0ZFZ3 Cluster: Helicase domain protein; n=3; Bacteria|Rep: Helicase domain protein - Nodularia spumigena CCY 9414 Length = 1004 Score = 32.3 bits (70), Expect = 7.6 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +1 Query: 331 TIIEDSLNNSLKIKFDMSSIPLTLPKRVNRNXQPRSIPRXWYNLMNDLYAPFN 489 T+ + + N +IK+D + L KR+N+N QP+ I + Y N Y F+ Sbjct: 690 TLKDSNYTNKNQIKWDRE-LTKYLDKRINKNFQPQQIIKSLYRPYNQQYLYFD 741 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 503,861,319 Number of Sequences: 1657284 Number of extensions: 9397146 Number of successful extensions: 17082 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17081 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 35822246242 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -