BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2106 (550 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 25 1.2 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 25 2.2 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 25.4 bits (53), Expect = 1.2 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 181 AFRYEEWCSRCTVKPXNSYLKMGDG--ICVANSYG 279 AF+ E + + K SYL GDG +C+A +G Sbjct: 413 AFKPERFEDKTFAKTNPSYLAFGDGPRMCIAMRFG 447 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 24.6 bits (51), Expect = 2.2 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 4 HTASMKYKKGLRYIYANYTIILPEFIL*VPEISGKI 111 +T +KYKK +Y N I + L +PE + K+ Sbjct: 1133 YTVQLKYKKNTKYFNINSEQIDVQNFLEIPEDTKKL 1168 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 537,056 Number of Sequences: 2352 Number of extensions: 10252 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -