BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2106 (550 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043706-2|AAB97604.2| 730|Caenorhabditis elegans Hypothetical ... 29 2.2 Z46676-3|CAA86663.1| 1244|Caenorhabditis elegans Hypothetical pr... 28 3.9 >AF043706-2|AAB97604.2| 730|Caenorhabditis elegans Hypothetical protein ZC123.1 protein. Length = 730 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 169 TAGSLYLFKRAHKNLQKNLKF 107 TAG LY F+RAH +++N+ F Sbjct: 307 TAGRLYDFRRAHVRVKRNMNF 327 >Z46676-3|CAA86663.1| 1244|Caenorhabditis elegans Hypothetical protein C08B11.3 protein. Length = 1244 Score = 28.3 bits (60), Expect = 3.9 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -2 Query: 195 FISKRITASRQGPCTYSSGLTRISKKTLNFPRYFGNS*YELRKNNSVIC 49 F+S+ +T +GP T S LT N RY +LR++ S IC Sbjct: 1060 FLSRELTDEAEGPVTKSIRLTS-CLILRNLARYSAEGRQKLRRHESHIC 1107 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,515,593 Number of Sequences: 27780 Number of extensions: 220951 Number of successful extensions: 398 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 398 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -