Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-2105
         (400 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EU019709-1|ABU25221.1|  540|Tribolium castaneum aspartate 1-deca...    22   1.9  
EF592537-1|ABQ95983.1|  593|Tribolium castaneum beta-N-acetylglu...    22   1.9  

>EU019709-1|ABU25221.1|  540|Tribolium castaneum aspartate
           1-decarboxylase protein.
          Length = 540

 Score = 22.2 bits (45), Expect = 1.9
 Identities = 11/39 (28%), Positives = 20/39 (51%)
 Frame = +2

Query: 2   SHVNVLLKISIN**NHHDGRVFLWXHPFIITSVRDMGIQ 118
           S V+VLL+ ++    +   RV  W  P  +  + D G++
Sbjct: 68  SSVDVLLQEAVFEGTNRKNRVLQWREPEELRRLMDFGVR 106


>EF592537-1|ABQ95983.1|  593|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG2 protein.
          Length = 593

 Score = 22.2 bits (45), Expect = 1.9
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -3

Query: 185 GIWTYQCLTNDE 150
           GIW +QC T++E
Sbjct: 28  GIWYWQCNTDEE 39


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 93,447
Number of Sequences: 336
Number of extensions: 1947
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 51
effective length of database: 105,449
effective search space used:  8541369
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)