BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2105 (400 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) 28 3.2 SB_27119| Best HMM Match : CBM_14 (HMM E-Value=4.1e-15) 27 4.3 SB_13268| Best HMM Match : Glyco_transf_54 (HMM E-Value=5.6e-15) 27 5.6 SB_50351| Best HMM Match : I-set (HMM E-Value=0.00016) 26 9.8 SB_35706| Best HMM Match : ig (HMM E-Value=1.6) 26 9.8 >SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) Length = 339 Score = 27.9 bits (59), Expect = 3.2 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +2 Query: 164 SIGRSRCP-TR*IKCDPGGSHVPPRSSKTXXPXX*KVGESRXCPSGH 301 S+ ++ C R + CD GG++ PP P K+G + +GH Sbjct: 153 SVTKTTCDWPRYVDCDIGGAYKPPFRCNLRDPIPKKIGCLKGWENGH 199 >SB_27119| Best HMM Match : CBM_14 (HMM E-Value=4.1e-15) Length = 220 Score = 27.5 bits (58), Expect = 4.3 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 164 SIGRSRCP-TR*IKCDPGGSHVPPRSSKTXXPXX*KVGESRXCPSGH 301 S+ ++ C R + CD GG++ PP P K+G + GH Sbjct: 60 SVTKTTCDWPRYVDCDIGGAYKPPFRCNLRDPIPKKIGCLKGWEDGH 106 >SB_13268| Best HMM Match : Glyco_transf_54 (HMM E-Value=5.6e-15) Length = 642 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 75 VTLSSSHQSETWGSRGKAEYPRSTKLVIRQALVGPDAQPD 194 + L + E WG+R EY KL R++ VG +++ D Sbjct: 198 IKLGYPKRDEQWGARISKEYELDRKLTTRES-VGAESEED 236 >SB_50351| Best HMM Match : I-set (HMM E-Value=0.00016) Length = 419 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 182 CPTR*IKCDPGGSHVPPRSS 241 CP R + C GSHVPP+ S Sbjct: 138 CPFR-VSCGALGSHVPPQES 156 >SB_35706| Best HMM Match : ig (HMM E-Value=1.6) Length = 120 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/42 (26%), Positives = 18/42 (42%) Frame = -1 Query: 232 GRDMASXWITFNSSGWASGPTNA*RMTSLVLRGYSALPLDPH 107 GR + F+ GW + +T L+ R + + L PH Sbjct: 65 GRYFCKLYTNFDHGGWTNTRVEVANITQLLSRSFCSCLLKPH 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,282,232 Number of Sequences: 59808 Number of extensions: 229357 Number of successful extensions: 409 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 409 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 703143849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -