BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2105 (400 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ420779-1|CAD12646.1| 2347|Homo sapiens calcium channel, voltag... 30 3.3 AF073931-1|AAD17668.1| 2353|Homo sapiens low-voltage activated c... 30 3.3 AF051946-1|AAC67239.3| 2353|Homo sapiens T-type calcium channel ... 30 3.3 AL031703-1|CAC42094.1| 808|Homo sapiens c302G6.1 (calcium chann... 29 4.3 AE006466-3|AAK61268.1| 2373|Homo sapiens voltage dependent t-typ... 29 4.3 >AJ420779-1|CAD12646.1| 2347|Homo sapiens calcium channel, voltage-dependent, T type, alphant regulator of chromatin, sub protein. Length = 2347 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 77 HPFIITSVRDMGIQRQSRIPTQHQARHSSSIG 172 +PFI +S RD G+Q+ S IP + + R ++G Sbjct: 287 NPFICSSRRDNGMQKCSHIPGRRELRMPCTLG 318 >AF073931-1|AAD17668.1| 2353|Homo sapiens low-voltage activated calcium channel alpha 1H protein. Length = 2353 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 77 HPFIITSVRDMGIQRQSRIPTQHQARHSSSIG 172 +PFI +S RD G+Q+ S IP + + R ++G Sbjct: 287 NPFICSSRRDNGMQKCSHIPGRRELRMPCTLG 318 >AF051946-1|AAC67239.3| 2353|Homo sapiens T-type calcium channel alpha 1H subunit protein. Length = 2353 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 77 HPFIITSVRDMGIQRQSRIPTQHQARHSSSIG 172 +PFI +S RD G+Q+ S IP + + R ++G Sbjct: 287 NPFICSSRRDNGMQKCSHIPGRRELRMPCTLG 318 >AL031703-1|CAC42094.1| 808|Homo sapiens c302G6.1 (calcium channel, voltage-dependent, alpha 1H subunit) protein. Length = 808 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 77 HPFIITSVRDMGIQRQSRIPTQHQARHSSSIG 172 +PFI +S RD G+Q+ S IP + + R ++G Sbjct: 230 NPFICSSRRDNGMQKCSHIPGRRELRVPCTLG 261 >AE006466-3|AAK61268.1| 2373|Homo sapiens voltage dependent t-type calcium channel alpha-1H subunit protein. Length = 2373 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 77 HPFIITSVRDMGIQRQSRIPTQHQARHSSSIG 172 +PFI +S RD G+Q+ S IP + + R ++G Sbjct: 307 NPFICSSRRDNGMQKCSHIPGRRELRVPCTLG 338 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,140,070 Number of Sequences: 237096 Number of extensions: 1276172 Number of successful extensions: 2121 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2121 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2870859500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -