BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2102 (500 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 24 0.77 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.2 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 9.5 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 9.5 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 24.2 bits (50), Expect = 0.77 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 362 IQVIKNLSRRHXDHMFFFYXP 424 IQ++ NL RR H+F Y P Sbjct: 203 IQIVFNLRRRLGYHLFHTYIP 223 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 7.2 Identities = 15/71 (21%), Positives = 36/71 (50%), Gaps = 4/71 (5%) Frame = +2 Query: 5 PKGYETEVGERGLKLS----GGEKQRVGIARAILKDAPLLLHDEATSSLDSLTEHAILQA 172 P G+ETE+ ++ L+L G+ ++ + +++D L+ D + + +I+ Sbjct: 83 PDGWETEISDQMLELRDLPISGKPFQIRMKHGLIRD---LIVDRDVPTWEVNILKSIVGQ 139 Query: 173 LKAATVGKTSI 205 L+ T G+ ++ Sbjct: 140 LQVDTQGENAV 150 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 325 TTSSGRNRTNIPYP 366 T+ SG+N+ PYP Sbjct: 85 TSPSGQNKAVAPYP 98 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 325 TTSSGRNRTNIPYP 366 T+ SG+N+ PYP Sbjct: 85 TSPSGQNKAVAPYP 98 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,010 Number of Sequences: 438 Number of extensions: 1433 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -