BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2092 (400 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g63560.1 68414.m07185 receptor-like protein kinase-related co... 27 3.5 At2g07680.1 68415.m00992 ABC transporter family protein 27 4.6 >At1g63560.1 68414.m07185 receptor-like protein kinase-related contains Pfam profile: PF01657 Domain of unknown function DUF26; weak similarity to receptor-like protein kinase 5 (GI:13506747) [Arabidopsis thaliana] Length = 273 Score = 27.5 bits (58), Expect = 3.5 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +2 Query: 116 SDLTIRLSITIFFSSSCCKGY*LADLRSCSDVLKTIAMSRTRRNN 250 S+ TI LS + C+G SCSD +KT + T+ NN Sbjct: 46 SNATIGLSPDTVYGMFLCRGD--LTKTSCSDCVKTATLEITKNNN 88 >At2g07680.1 68415.m00992 ABC transporter family protein Length = 1194 Score = 27.1 bits (57), Expect = 4.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 99 HL*SMLVT*LSDYPLQFFSQAPAAKAIN*QTFDL 200 H+ + L++ L + P QFF Q P+ + +N + DL Sbjct: 708 HVHNALISKLINAPTQFFDQTPSGRILNRFSSDL 741 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,411,283 Number of Sequences: 28952 Number of extensions: 69807 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 575830496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -