BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2090 (472 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 2.2 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 8.8 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 8.8 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.6 bits (46), Expect = 2.2 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 111 HLESGGCRCRAILARSVRQSLGRHQCP*PDHQHRLWSGCC 230 +L SGGC C+ V + +CP +H S C Sbjct: 241 YLPSGGCHCKPGYQADVEKQ-ECTECPIGKFKHEAGSHSC 279 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 20.6 bits (41), Expect = 8.8 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 145 YWPGLFAKALEGINVRDLITNIGSGVGAA 231 +WP + ALEG + + I N + A+ Sbjct: 223 FWPSFNSAALEGDDQQRAIINTLLSISAS 251 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 20.6 bits (41), Expect = 8.8 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -2 Query: 411 KLYNRQNGIFL 379 +LY+RQNG+ L Sbjct: 282 RLYDRQNGLVL 292 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,385 Number of Sequences: 438 Number of extensions: 1798 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12682287 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -