BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2082 (600 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC776.14 |plh1||phospholipid-diacylglycerol acyltransferase Pl... 26 4.8 SPBC19C2.13c |||conserved eukaryotic protein|Schizosaccharomyces... 25 8.5 >SPBC776.14 |plh1||phospholipid-diacylglycerol acyltransferase Plh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 623 Score = 25.8 bits (54), Expect = 4.8 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 192 SRWRSPIETSXPPSPRIRI 248 S+W +P+ETS P +P ++I Sbjct: 462 SKWINPLETSLPYAPDMKI 480 >SPBC19C2.13c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 366 Score = 25.0 bits (52), Expect = 8.5 Identities = 14/57 (24%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +2 Query: 131 DDLLTAVITPTMSRDYYR-PWKQMAIANRDVGSTITSNKDKFQVNLXVQHFSPEXIS 298 D + I ++S++Y + P+K + A + T ++ ++N + F+PE IS Sbjct: 107 DSAVAKTIEESISKNYPKCPFKVIGEAELLNRTIATDSRGNIEINADNEKFNPEVIS 163 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,832,592 Number of Sequences: 5004 Number of extensions: 30685 Number of successful extensions: 78 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -