BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2082 (600 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0215 + 18692662-18692862,18693049-18693276 28 6.6 07_01_1131 - 10510404-10511000 27 8.7 03_02_0328 - 7487759-7488340 27 8.7 >03_04_0215 + 18692662-18692862,18693049-18693276 Length = 142 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 106 DFGLALTSGRSPDGRHHANDV--QRLLPSVEADGDR 207 DF + G++ D +HHA QR+L SVE + DR Sbjct: 93 DFTVGAVLGQTKDRKHHAIAYLHQRMLHSVEQNDDR 128 >07_01_1131 - 10510404-10511000 Length = 198 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -3 Query: 169 GHR-WRDDGRQEIVRK*APVRSPDREGGSVGIPG*WQQ 59 GHR W DG + + R +PVR D GG W++ Sbjct: 20 GHRRWGSDGGEAMPRTTSPVRRCDAGGGGGVADSAWEE 57 >03_02_0328 - 7487759-7488340 Length = 193 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = +3 Query: 69 YPGIPTEPPSRSGLRTGAYFRTIS*RPSSRQRCPEITTVRGSRWRSPIE--TSXPPSPRI 242 YP P +PP T + + R SR TT G++ + P+E T PP+P + Sbjct: 58 YPPPPQQPPRSGRASTPSTRQRDRRRKPSRPPPSTETTKGGTQKKKPLERATPLPPAPAV 117 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,756,926 Number of Sequences: 37544 Number of extensions: 235164 Number of successful extensions: 689 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1435654836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -