BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2076 (650 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 23 2.2 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 2.9 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 22 3.8 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 22 3.8 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 6.7 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 23.0 bits (47), Expect = 2.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 Query: 243 RYPIFYRWDHFLE 205 R PIFYRW +++ Sbjct: 395 RDPIFYRWHSYID 407 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 2.9 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +1 Query: 298 GGRQKWKTSFNNFPGKSISNVSNQHSPGWNDIG 396 GG ++T N PG S SN + W + G Sbjct: 338 GGEDLFRTMANAAPGNSASNRHSAWQSHWLNKG 370 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 610 NGXPGYVSVGVFYHSSRXILAXRAT 536 NG P Y+S VF +++ I+ A+ Sbjct: 444 NGDPNYISPEVFPNTNNAIMTPPAS 468 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 610 NGXPGYVSVGVFYHSSRXILAXRAT 536 NG P Y+S VF +++ I+ A+ Sbjct: 392 NGDPNYISPEVFPNTNNAIMTPPAS 416 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.4 bits (43), Expect = 6.7 Identities = 5/20 (25%), Positives = 14/20 (70%) Frame = -1 Query: 362 ETFEIDXPGKLLKEVFHFCR 303 +++ + G+ ++++ HFCR Sbjct: 425 DSYNLAGMGETIEDLLHFCR 444 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,844 Number of Sequences: 336 Number of extensions: 3842 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -