BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2076 (650 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0305 - 16162063-16162096,16162282-16164365,16165283-161653... 30 1.8 05_02_0066 - 6284265-6284600,6284671-6284773,6285262-6285380 29 3.2 01_01_0507 - 3704314-3704449,3705038-3705094,3705219-3705297,370... 27 9.8 >11_04_0305 - 16162063-16162096,16162282-16164365,16165283-16165351, 16168317-16169288,16169548-16169650,16170427-16170509 Length = 1114 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -2 Query: 262 FTEFGGSVPDFLSLGPFSRTPTCTYRMLYLK 170 F FG S+P+++ + P SRTP + R L+LK Sbjct: 842 FGYFGCSLPNWM-MSPISRTPLTSLRYLFLK 871 >05_02_0066 - 6284265-6284600,6284671-6284773,6285262-6285380 Length = 185 Score = 29.1 bits (62), Expect = 3.2 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -3 Query: 237 PIFYRWDHFLERQHV 193 P+ YRW +F+ER+HV Sbjct: 29 PVCYRWMYFIEREHV 43 >01_01_0507 - 3704314-3704449,3705038-3705094,3705219-3705297, 3705380-3705486,3705833-3705949,3706077-3706165, 3706668-3706721,3706800-3706866,3706971-3707128, 3707318-3707386,3707481-3707618,3707706-3707740, 3707829-3707952 Length = 409 Score = 27.5 bits (58), Expect = 9.8 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +1 Query: 1 GSFXAFSGLLFKNIFLLGVPFVHSKPVKSLRT*FNHGR 114 G F A G + LLG+PF+ S PV+ + FN GR Sbjct: 203 GVFFALLGAAALQV-LLGMPFLLSHPVEYISRAFNLGR 239 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,666,846 Number of Sequences: 37544 Number of extensions: 403234 Number of successful extensions: 754 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 754 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -