BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2076 (650 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18460.1 68416.m02346 hypothetical protein similar to PGPS/D1... 28 4.7 At2g38590.1 68415.m04740 F-box family protein contains Pfam prof... 28 4.7 At3g52140.1 68416.m05723 tetratricopeptide repeat (TPR)-containi... 27 8.2 >At3g18460.1 68416.m02346 hypothetical protein similar to PGPS/D12 [Petunia x hybrida] GI:4105794; contains Pfam profile PF04749: Protein of unknown function, DUF614 Length = 184 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 13 AFSGLLFKNIFLLGVPFVHS 72 A GLL+ IF +GVPFV+S Sbjct: 94 ATGGLLYGMIFFIGVPFVYS 113 >At2g38590.1 68415.m04740 F-box family protein contains Pfam profile: PF00646 F-box domain Length = 424 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 446 HFSRCRYFLKYRERENAREKNLXLWLKIFLGGPXGQY 556 H R Y L Y+++E+ L ++ FLG P QY Sbjct: 153 HKDRFIYALGYKDKESRGSFQLLRFVDYFLGAPKNQY 189 >At3g52140.1 68416.m05723 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 1403 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 320 VFHFCRPPPSHFRSVGMITIYGIRGL-GTRFFIAGT 216 VF PPPSH R VG + + L G ++ I GT Sbjct: 274 VFSSFNPPPSHRRLVGDLIYLDVVTLEGNKYCITGT 309 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,991,498 Number of Sequences: 28952 Number of extensions: 327384 Number of successful extensions: 653 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -