BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2064 (650 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0249 + 2047793-2048561,2049861-2049896,2050068-2051012,205... 29 4.2 03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838,235... 27 9.8 >01_01_0249 + 2047793-2048561,2049861-2049896,2050068-2051012, 2051215-2051264 Length = 599 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -2 Query: 346 HRTSLHVSIASKISFALYCFDDSTTTIRS*YILLIVTNYT 227 +R+SL ++ SF L+C D ++R IL++ +YT Sbjct: 47 NRSSLAIAACGHPSFELWCSRDGVASLRGSQILVLGIDYT 86 >03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838, 2353031-2353708,2353800-2353964,2354139-2354433, 2354581-2354795,2354885-2355190,2355269-2355332, 2355426-2355665,2355783-2355886 Length = 1505 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 415 CIRYTVY-TFGMVFXSSLSWVSPLAXXLPAXPVSTSRVKL 531 C+R T Y G+V ++LSW+SPL P+ + + L Sbjct: 225 CLRVTPYGDAGIVSLATLSWLSPLLSVGAQRPLELADIPL 264 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,586,234 Number of Sequences: 37544 Number of extensions: 203356 Number of successful extensions: 469 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 469 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -