Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-2054
         (650 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014134-2531|AAX52665.1|  739|Drosophila melanogaster CG15279-P...    28   9.6  

>AE014134-2531|AAX52665.1|  739|Drosophila melanogaster CG15279-PC,
           isoform C protein.
          Length = 739

 Score = 28.3 bits (60), Expect = 9.6
 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 4/65 (6%)
 Frame = +2

Query: 170 PCXASKCXPQS-NNEDHSMFPGVEYHELPRHEPASGDDTWFLVLITXCIAVLG---IAAF 337
           P   S C   S  N   S+   ++   LP+ +P +  + +FL      +A++G   I +F
Sbjct: 202 PEWESFCVASSLGNTSQSLASPMDMDSLPQRQPVASAELYFLTYYAALVAIIGRYFIESF 261

Query: 338 TGTLP 352
              LP
Sbjct: 262 RNPLP 266


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,135,351
Number of Sequences: 53049
Number of extensions: 509179
Number of successful extensions: 1067
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1026
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1066
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2765538900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)