Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-2054
         (650 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g35520.1 68417.m05049 DNA mismatch repair family protein simi...    29   3.5  

>At4g35520.1 68417.m05049 DNA mismatch repair family protein similar
           to SP|Q9UHC1 DNA mismatch repair protein Mlh3 (MutL
           protein homolog 3) {Homo sapiens}; contains Pfam
           profiles PF02518: ATPase, histidine kinase-, DNA gyrase
           B-, and HSP90-like domain protein, PF01119: DNA mismatch
           repair protein, C-terminal domain
          Length = 1151

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 4/38 (10%)
 Frame = -3

Query: 285 HVSSPLAGS-CLGSSW---YSTPGNMEWSSLFDCGXHL 184
           +V S + GS CL S W   YSTP   +W S +  G  +
Sbjct: 624 NVGSSVTGSFCLSSEWSPMYSTPSATKWESEYQKGCRI 661


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,159,982
Number of Sequences: 28952
Number of extensions: 230691
Number of successful extensions: 509
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 495
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 509
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1354097952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)