BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2046 (600 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC008596-1|AAH08596.1| 336|Homo sapiens TMEM19 protein protein. 35 0.19 AK001798-1|BAA91918.1| 298|Homo sapiens protein ( Homo sapiens ... 35 0.19 AK223148-1|BAD96868.1| 336|Homo sapiens transmembrane protein 1... 33 0.58 >BC008596-1|AAH08596.1| 336|Homo sapiens TMEM19 protein protein. Length = 336 Score = 35.1 bits (77), Expect = 0.19 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 2/69 (2%) Frame = +3 Query: 84 TKQLMAS-RCVTK-AAIAGHDGNVWAKSEGFEISKDEVAKIVAGFENESLLTSGGVTIAG 257 +KQ AS C++ AA+A G+ WA G +SK +++ +E + T+GGVT+ G Sbjct: 164 SKQYSASWMCLSLLAALACSAGDTWASEVGPVLSKSS-PRLITTWEKVPVGTNGGVTVVG 222 Query: 258 TRYIYLSGT 284 L GT Sbjct: 223 LVSSLLGGT 231 >AK001798-1|BAA91918.1| 298|Homo sapiens protein ( Homo sapiens cDNA FLJ10936 fis, clone OVARC1000959, weakly similar to HYPOTHETICAL PROTEIN MJ0933. ). Length = 298 Score = 35.1 bits (77), Expect = 0.19 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 2/69 (2%) Frame = +3 Query: 84 TKQLMAS-RCVTK-AAIAGHDGNVWAKSEGFEISKDEVAKIVAGFENESLLTSGGVTIAG 257 +KQ AS C++ AA+A G+ WA G +SK +++ +E + T+GGVT+ G Sbjct: 164 SKQYSASWMCLSLLAALACSAGDTWASEVGPVLSKSS-PRLITTWEKVPVGTNGGVTVVG 222 Query: 258 TRYIYLSGT 284 L GT Sbjct: 223 LVSSLLGGT 231 >AK223148-1|BAD96868.1| 336|Homo sapiens transmembrane protein 19 variant protein. Length = 336 Score = 33.5 bits (73), Expect = 0.58 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 2/69 (2%) Frame = +3 Query: 84 TKQLMAS-RCVTK-AAIAGHDGNVWAKSEGFEISKDEVAKIVAGFENESLLTSGGVTIAG 257 +KQ AS C++ A+A G+ WA G +SK +++ +E + T+GGVT+ G Sbjct: 164 SKQYSASWMCLSLLVALACSAGDTWASEVGPVLSKSS-PRLITTWEKVPVGTNGGVTVVG 222 Query: 258 TRYIYLSGT 284 L GT Sbjct: 223 LVSSLLGGT 231 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,625,585 Number of Sequences: 237096 Number of extensions: 1781029 Number of successful extensions: 2974 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2974 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6297951520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -