BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2046 (600 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. 213 8e-58 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 3.0 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 4.0 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.2 >AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. Length = 126 Score = 213 bits (521), Expect = 8e-58 Identities = 95/118 (80%), Positives = 110/118 (93%) Frame = +3 Query: 87 KQLMASRCVTKAAIAGHDGNVWAKSEGFEISKDEVAKIVAGFENESLLTSGGVTIAGTRY 266 KQL+ASRCVTKAAIAGHDGN+WAKSEGFE+SK+E+ K+V GFE + +LTS GVT+AG RY Sbjct: 9 KQLLASRCVTKAAIAGHDGNLWAKSEGFEVSKEELTKLVQGFEEQDILTSSGVTLAGNRY 68 Query: 267 IYLSGTDHIIRAKLGKVGVHCMKTQQAVVISLYEEPIQPQQAASVVEKLGEYLITCGY 440 IYLSGTD +IRAKLGKVGVHCMKT QAVV+SLYE+PIQPQQAASVVEKLG+YL++CGY Sbjct: 69 IYLSGTDRVIRAKLGKVGVHCMKTTQAVVVSLYEDPIQPQQAASVVEKLGDYLVSCGY 126 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.6 bits (46), Expect = 3.0 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 380 LDGFFIERNDHSLLCLH 330 + G IER DH++LC++ Sbjct: 327 ISGAPIERPDHAVLCVY 343 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = -1 Query: 162 PTL-PTHCHHDRQWQLL*HI 106 PT+ P H HH Q Q L H+ Sbjct: 345 PTMGPPHHHHHHQTQSLQHL 364 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 9.2 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = +3 Query: 324 HCMKTQQAVVIS 359 HC+ T+Q+VV++ Sbjct: 822 HCVTTEQSVVVT 833 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,547 Number of Sequences: 438 Number of extensions: 3107 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -