BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2039 (550 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 25 0.58 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 25 0.58 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 25 0.58 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 1.8 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 1.8 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 24.6 bits (51), Expect = 0.58 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 148 ILILGLDGAGKTTILYKL 201 + ILG GAGKTT+L L Sbjct: 107 LAILGSSGAGKTTLLNTL 124 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 24.6 bits (51), Expect = 0.58 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 148 ILILGLDGAGKTTILYKL 201 + ILG GAGKTT+L L Sbjct: 107 LAILGSSGAGKTTLLNTL 124 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 24.6 bits (51), Expect = 0.58 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = +2 Query: 443 EPRYSLFLXHKQDXAGCFDNXPRXPQXPGLG 535 + R+ + H CF PR P PG G Sbjct: 181 QQRWQNSIRHSLSFNDCFVKVPRTPDKPGKG 211 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 1.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 330 TSPIRPNTGLSPKIPHL 280 T I P+ GLSP PHL Sbjct: 227 TGLIPPHPGLSPHPPHL 243 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 1.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 330 TSPIRPNTGLSPKIPHL 280 T I P+ GLSP PHL Sbjct: 119 TGLIPPHPGLSPHPPHL 135 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,484 Number of Sequences: 336 Number of extensions: 2238 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -