BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2037 (676 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0244 + 1603381-1603792,1604054-1604132,1604993-1605862,160... 29 4.5 >02_01_0244 + 1603381-1603792,1604054-1604132,1604993-1605862, 1606019-1606276,1606675-1606834 Length = 592 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 334 NFYLQITISTEFKFKKGFSVEDACAFI*KKSNVFNDL 444 N +Q + T+ +K S+ C+FI K SN+ ND+ Sbjct: 367 NLEMQAKLDTQRDYKLTKSISLGCSFIVKASNLVNDV 403 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,964,444 Number of Sequences: 37544 Number of extensions: 195164 Number of successful extensions: 270 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 270 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 270 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -