BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2031 (550 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT014643-1|AAT27267.1| 268|Drosophila melanogaster RE55992p pro... 48 6e-06 AF181658-1|AAD55443.1| 244|Drosophila melanogaster GM04779p pro... 48 6e-06 AE014296-1506|AAF50377.2| 244|Drosophila melanogaster CG33162-P... 48 6e-06 AY084181-1|AAL89919.1| 308|Drosophila melanogaster RE54230p pro... 28 9.6 AE013599-900|AAM71078.1| 308|Drosophila melanogaster CG30339-PA... 28 9.6 >BT014643-1|AAT27267.1| 268|Drosophila melanogaster RE55992p protein. Length = 268 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/45 (48%), Positives = 30/45 (66%) Frame = +1 Query: 7 LGKEGKDFEFSHIRNKVEFAECSANTNDDENPTDIKPLQDWISKL 141 LGK G+DFEFSHI ++FAE SA T++ PL DW+++L Sbjct: 229 LGKPGRDFEFSHIAQNIQFAEASA------KDTELDPLTDWLARL 267 >AF181658-1|AAD55443.1| 244|Drosophila melanogaster GM04779p protein. Length = 244 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/45 (48%), Positives = 30/45 (66%) Frame = +1 Query: 7 LGKEGKDFEFSHIRNKVEFAECSANTNDDENPTDIKPLQDWISKL 141 LGK G+DFEFSHI ++FAE SA T++ PL DW+++L Sbjct: 205 LGKPGRDFEFSHIAQNIQFAEASA------KDTELDPLTDWLARL 243 >AE014296-1506|AAF50377.2| 244|Drosophila melanogaster CG33162-PA protein. Length = 244 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/45 (48%), Positives = 30/45 (66%) Frame = +1 Query: 7 LGKEGKDFEFSHIRNKVEFAECSANTNDDENPTDIKPLQDWISKL 141 LGK G+DFEFSHI ++FAE SA T++ PL DW+++L Sbjct: 205 LGKPGRDFEFSHIAQNIQFAEASA------KDTELDPLTDWLARL 243 >AY084181-1|AAL89919.1| 308|Drosophila melanogaster RE54230p protein. Length = 308 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 64 AECSANTNDDENPTDIKPLQDWISK 138 AE N ++ P D+K L+DW++K Sbjct: 15 AETELNEVEERVPADLKALRDWLAK 39 >AE013599-900|AAM71078.1| 308|Drosophila melanogaster CG30339-PA protein. Length = 308 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 64 AECSANTNDDENPTDIKPLQDWISK 138 AE N ++ P D+K L+DW++K Sbjct: 15 AETELNEVEERVPADLKALRDWLAK 39 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,221,479 Number of Sequences: 53049 Number of extensions: 397653 Number of successful extensions: 660 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 660 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2089831299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -