BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2031 (550 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81484-11|CAB03969.2| 365|Caenorhabditis elegans Hypothetical p... 28 3.9 AF067945-12|AAC17680.1| 840|Caenorhabditis elegans Patched rela... 27 6.7 >Z81484-11|CAB03969.2| 365|Caenorhabditis elegans Hypothetical protein C47A10.4 protein. Length = 365 Score = 28.3 bits (60), Expect = 3.9 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +3 Query: 99 SD*HQASAGLDFEAVD*NYHYYFFALPTILSI 194 SD Q+ +GL F A YHY FF + T+L I Sbjct: 107 SDGLQSRSGLLFWAALLRYHYMFFGVHTLLCI 138 >AF067945-12|AAC17680.1| 840|Caenorhabditis elegans Patched related family protein 15 protein. Length = 840 Score = 27.5 bits (58), Expect = 6.7 Identities = 11/42 (26%), Positives = 19/42 (45%) Frame = +2 Query: 59 NSQSVRPTRMTMKIRLTSSLCRIGFRSCRLKLSLLFFCTTYY 184 N ++ PTR + +CR R C L L +++ +Y Sbjct: 447 NENAISPTRYFFENIFAPFICRPSVRFCMLNLYVVYIAIAFY 488 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,664,751 Number of Sequences: 27780 Number of extensions: 238132 Number of successful extensions: 565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -