BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2029 (650 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY084185-1|AAL89923.1| 224|Drosophila melanogaster RE67583p pro... 34 0.19 AF276505-1|AAF85707.1| 224|Drosophila melanogaster neural Lazar... 34 0.19 AE014134-249|AAF51378.2| 224|Drosophila melanogaster CG33126-PA... 34 0.19 >AY084185-1|AAL89923.1| 224|Drosophila melanogaster RE67583p protein. Length = 224 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 104 PSLKPVNNFQL*QLYQGIWYEISKFPNESEKNGKCSSAEYKL 229 P +K ++ F + Y G+WYE + +P E KC A Y L Sbjct: 34 PDVKLLDTFDA-EAYMGVWYEYAAYPFAFEIGKKCIYANYSL 74 >AF276505-1|AAF85707.1| 224|Drosophila melanogaster neural Lazarillo protein. Length = 224 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 104 PSLKPVNNFQL*QLYQGIWYEISKFPNESEKNGKCSSAEYKL 229 P +K ++ F + Y G+WYE + +P E KC A Y L Sbjct: 34 PDVKLLDTFDA-EAYMGVWYEYAAYPFAFEIGKKCIYANYSL 74 >AE014134-249|AAF51378.2| 224|Drosophila melanogaster CG33126-PA protein. Length = 224 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 104 PSLKPVNNFQL*QLYQGIWYEISKFPNESEKNGKCSSAEYKL 229 P +K ++ F + Y G+WYE + +P E KC A Y L Sbjct: 34 PDVKLLDTFDA-EAYMGVWYEYAAYPFAFEIGKKCIYANYSL 74 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,502,302 Number of Sequences: 53049 Number of extensions: 399985 Number of successful extensions: 708 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2765538900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -