BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2026 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21029| Best HMM Match : PX (HMM E-Value=9.1e-15) 48 9e-06 SB_59316| Best HMM Match : LRR_1 (HMM E-Value=0) 44 1e-04 SB_19634| Best HMM Match : LRR_1 (HMM E-Value=2.6e-17) 41 0.001 SB_26267| Best HMM Match : TSP_C (HMM E-Value=0) 40 0.001 SB_41385| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_48318| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_7052| Best HMM Match : LRR_1 (HMM E-Value=2e-12) 37 0.012 SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) 36 0.022 SB_47414| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_30526| Best HMM Match : LRR_1 (HMM E-Value=8e-08) 36 0.038 SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_52308| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.066 SB_46788| Best HMM Match : LRR_1 (HMM E-Value=9.1e-12) 35 0.066 SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.066 SB_35937| Best HMM Match : LRR_1 (HMM E-Value=7.1e-09) 34 0.12 SB_13921| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_10598| Best HMM Match : LRR_1 (HMM E-Value=4.4e-19) 33 0.15 SB_7548| Best HMM Match : LRR_1 (HMM E-Value=8.7e-14) 33 0.15 SB_13886| Best HMM Match : 7tm_1 (HMM E-Value=1e-08) 33 0.15 SB_27801| Best HMM Match : LRR_1 (HMM E-Value=2.8e-15) 33 0.27 SB_10599| Best HMM Match : Tetraspannin (HMM E-Value=1.8e-10) 33 0.27 SB_38600| Best HMM Match : Ank (HMM E-Value=6.9e-36) 32 0.35 SB_33107| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.35 SB_14995| Best HMM Match : LRR_1 (HMM E-Value=4e-13) 32 0.35 SB_28720| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 SB_9680| Best HMM Match : Ank (HMM E-Value=4e-20) 31 1.1 SB_45368| Best HMM Match : fn2 (HMM E-Value=3.1e-32) 31 1.1 SB_38674| Best HMM Match : TIR (HMM E-Value=2.5e-31) 31 1.1 SB_6475| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_5807| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_51944| Best HMM Match : LRR_1 (HMM E-Value=7.7e-34) 30 1.9 SB_5894| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_45576| Best HMM Match : LRR_1 (HMM E-Value=2.7e-14) 29 2.5 SB_13883| Best HMM Match : 7tm_1 (HMM E-Value=6e-08) 29 2.5 SB_13884| Best HMM Match : LRR_1 (HMM E-Value=6.3e-06) 29 3.3 SB_15974| Best HMM Match : LRR_1 (HMM E-Value=7.1e-15) 29 4.3 SB_13209| Best HMM Match : LRR_1 (HMM E-Value=1.7e-13) 29 4.3 SB_20569| Best HMM Match : LRR_1 (HMM E-Value=1.1e-27) 29 4.3 SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37) 28 5.7 SB_5195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31796| Best HMM Match : SAP (HMM E-Value=3.5e-10) 28 5.7 SB_19790| Best HMM Match : LRR_1 (HMM E-Value=0.00028) 28 5.7 SB_29271| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 7.6 SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) 28 7.6 >SB_21029| Best HMM Match : PX (HMM E-Value=9.1e-15) Length = 1466 Score = 47.6 bits (108), Expect = 9e-06 Identities = 38/88 (43%), Positives = 49/88 (55%), Gaps = 6/88 (6%) Frame = +3 Query: 405 LPEIXTLDLSTNGIQ----NLNKFLHNAKKLVHLNLANNRIKELAMSHLPAXGSSLDLIN 572 L E+ LDLS N ++ NLN L N +KL NLANN++ + LDL + Sbjct: 991 LSELEVLDLSHNKLRAIPTNLNAKLGNIRKL---NLANNQLSCVDGLEKLYSLVELDLRS 1047 Query: 573 NLLRDVPSD--LGHLTSLEHLELEGNPL 650 NLL +V S +G L LE+L LEGNPL Sbjct: 1048 NLLTEVSSVVLIGDLPCLENLHLEGNPL 1075 >SB_59316| Best HMM Match : LRR_1 (HMM E-Value=0) Length = 680 Score = 43.6 bits (98), Expect = 1e-04 Identities = 29/87 (33%), Positives = 43/87 (49%), Gaps = 1/87 (1%) Frame = +3 Query: 393 SWIXLPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAMSHLPAXG-SSLDLI 569 S+ L ++ L LS N + L + N LV L L +N++ L S +LDL Sbjct: 375 SFCNLSKLWFLQLSKNHLTELPENFGNLTSLVELRLDSNQLSSLPASFANLTNVKTLDLY 434 Query: 570 NNLLRDVPSDLGHLTSLEHLELEGNPL 650 N L ++P L L +L L+L+GN L Sbjct: 435 RNKLSEIPRVLLKLENLMRLDLDGNKL 461 Score = 28.7 bits (61), Expect = 4.3 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 6/83 (7%) Frame = +3 Query: 414 IXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELA--MSHLPAXGSSLDLINNLLRD 587 + + D++ N I+NL + +A L HL NN I L LP +L L +N L D Sbjct: 204 LKSFDITGNHIENLPERFESACFLEHLYADNNNITWLPDWFGDLPNI-INLCLSDNELSD 262 Query: 588 --VPSDLGHLT--SLEHLELEGN 644 +P G ++ +L L+L GN Sbjct: 263 SALPDHFGSISGKTLSSLDLSGN 285 >SB_19634| Best HMM Match : LRR_1 (HMM E-Value=2.6e-17) Length = 267 Score = 40.7 bits (91), Expect = 0.001 Identities = 31/95 (32%), Positives = 47/95 (49%), Gaps = 12/95 (12%) Frame = +3 Query: 399 IXLPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELA-----MSHLPAXG---- 551 I L ++ LDL+ N I L + N L L L N ++EL ++ + G Sbjct: 147 IILRDLERLDLTNNDISGLPYKIGNMSNLKSLVLNGNPLRELRRDIVMIAVIDVDGLLRM 206 Query: 552 ---SSLDLINNLLRDVPSDLGHLTSLEHLELEGNP 647 +LDL NN + VP +LG++ L+ L+L GNP Sbjct: 207 SVLETLDLQNNNISQVPPELGNVRGLKALQLGGNP 241 Score = 33.5 bits (73), Expect = 0.15 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 5/87 (5%) Frame = +3 Query: 405 LPEIXTLD---LSTNGIQNLN-KFLHNAKKLVHLNLANNRIKELAMSHLPAXG-SSLDLI 569 LP + LD L+ N I L+ K L L+L +N + + + LDL Sbjct: 99 LPALVLLDELYLAYNKIAELDSKVFAGYSGLTVLDLHDNLLTSIPEDIIILRDLERLDLT 158 Query: 570 NNLLRDVPSDLGHLTSLEHLELEGNPL 650 NN + +P +G++++L+ L L GNPL Sbjct: 159 NNDISGLPYKIGNMSNLKSLVLNGNPL 185 >SB_26267| Best HMM Match : TSP_C (HMM E-Value=0) Length = 2996 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 6/55 (10%) Frame = +3 Query: 381 NWIM-SWIXLPEIXTLDLSTNGIQ-----NLNKFLHNAKKLVHLNLANNRIKELA 527 +WI +W LP + + + N I NL F N +LVHLNL+NN I+ +A Sbjct: 123 DWIPDNWFDLPNLEYMSVDNNQIDRISYPNLEPFFQNRSQLVHLNLSNNAIESIA 177 >SB_41385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 40.3 bits (90), Expect = 0.001 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 2/81 (2%) Frame = +3 Query: 414 IXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELA--MSHLPAXGSSLDLINNLLRD 587 + L L+ N + + + L HL++++N+++ L M L L L NN LR Sbjct: 53 LTALFLNDNNLTRIPPDISRLCNLRHLDVSSNKLRSLPAEMGDLVTLRELL-LSNNGLRV 111 Query: 588 VPSDLGHLTSLEHLELEGNPL 650 +P++LG L L+ L L GNPL Sbjct: 112 LPNELGKLFQLQTLGLSGNPL 132 >SB_48318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1243 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/85 (32%), Positives = 40/85 (47%), Gaps = 1/85 (1%) Frame = +3 Query: 399 IXLPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKEL-AMSHLPAXGSSLDLINN 575 + L ++ L+LS N I N + L L L N+ ++ L A LDL NN Sbjct: 72 LELTQLQVLNLSGNHITNFPYRFFMLRFLTELYLRNDFLEFLPAQVCTLVQLEVLDLANN 131 Query: 576 LLRDVPSDLGHLTSLEHLELEGNPL 650 +R +P GHLT L L L+ N + Sbjct: 132 FIRTLPYSSGHLTRLRWLNLQNNQI 156 Score = 34.3 bits (75), Expect = 0.087 Identities = 28/83 (33%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = +3 Query: 405 LPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAMSHLPAXG-SSLDLINNLL 581 L ++ LDL+ N I+ L + +L LNL NN+I L S G L+L N L Sbjct: 120 LVQLEVLDLANNFIRTLPYSSGHLTRLRWLNLQNNQITNLPSSLADMNGLCYLNLEANEL 179 Query: 582 RDVPSDLGHLTSLEHLELEGNPL 650 + VP + L L+ L L N + Sbjct: 180 KIVPEVVTKLEKLQVLILSDNEI 202 >SB_7052| Best HMM Match : LRR_1 (HMM E-Value=2e-12) Length = 1328 Score = 37.1 bits (82), Expect = 0.012 Identities = 31/86 (36%), Positives = 40/86 (46%), Gaps = 4/86 (4%) Frame = +3 Query: 405 LPEIXTLDLSTNGIQNLNKFLHNA-KKLVHLNLANNRIKELAMSHLPAXG-SSLDLINNL 578 L + LDLS N +Q+ LH A KL H+NL++N + + SLDL N Sbjct: 972 LRNVERLDLSGNFLQDFPPLLHEAMPKLEHMNLSHNEFETFPYCLVKCKRLKSLDLSYNK 1031 Query: 579 LRDVPSDLGHLTS--LEHLELEGNPL 650 L + P L S LE L L N L Sbjct: 1032 LTNSPPPLSISASILLEDLSLAHNVL 1057 >SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) Length = 337 Score = 36.3 bits (80), Expect = 0.022 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 3/95 (3%) Frame = +3 Query: 375 LPNWIMSWIXLPEIXTLDLSTNGIQNL-NKFLHNAKKLVHLNLANNRIKELAMSHLPAXG 551 L N+ + L ++ L L + I L +F LV L+L +N+++ L S + G Sbjct: 93 LSNFPTGLLELTQLEYLYLKGSQISALPEEFFRKLINLVWLDLRDNQLENLPNS-IGEHG 151 Query: 552 --SSLDLINNLLRDVPSDLGHLTSLEHLELEGNPL 650 +L L N L+ +P +LG L SL + L GNP+ Sbjct: 152 RLKTLLLQGNKLKILPLELGLLNSLSAISLSGNPI 186 >SB_47414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 520 Score = 36.3 bits (80), Expect = 0.022 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 2/78 (2%) Frame = +3 Query: 423 LDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELA--MSHLPAXGSSLDLINNLLRDVPS 596 LD+S N +++L + + N + + + ANN I+ L + L LDL N L +P Sbjct: 137 LDISHNRLESLPEGIFNLELIAEIYAANNLIQALGNEVGCLHVL-KVLDLSENKLEAIPC 195 Query: 597 DLGHLTSLEHLELEGNPL 650 +L L+ L L+ NP+ Sbjct: 196 ELADCLKLKDLNLKENPI 213 Score = 35.1 bits (77), Expect = 0.050 Identities = 24/84 (28%), Positives = 48/84 (57%), Gaps = 2/84 (2%) Frame = +3 Query: 405 LPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKEL--AMSHLPAXGSSLDLINNL 578 + + TL+L+ N + + L NAK L L++++NR++ L + +L + + NNL Sbjct: 109 MEHLQTLNLNCNALTTVPP-LRNAKNLARLDISHNRLESLPEGIFNLELI-AEIYAANNL 166 Query: 579 LRDVPSDLGHLTSLEHLELEGNPL 650 ++ + +++G L L+ L+L N L Sbjct: 167 IQALGNEVGCLHVLKVLDLSENKL 190 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +3 Query: 555 SLDLINNLLRDVPSDLGHLTSLEHLELEGNPL 650 +LD+ N ++ +PS +G L ++ ++ GN L Sbjct: 68 TLDMHRNAIKSIPSTIGKLKDVKAIDFSGNSL 99 >SB_30526| Best HMM Match : LRR_1 (HMM E-Value=8e-08) Length = 219 Score = 35.5 bits (78), Expect = 0.038 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = +3 Query: 405 LPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKEL-AMSHLPAXGS--SLDLIN 572 LP + L+LS N I + + L + KL HL+L+ N+IK+L + L + SLDL N Sbjct: 59 LPNLRKLELSDNRISSGLQNLTGSPKLTHLSLSGNKIKDLETLEPLEKLSNLKSLDLFN 117 >SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2229 Score = 35.5 bits (78), Expect = 0.038 Identities = 29/79 (36%), Positives = 41/79 (51%), Gaps = 2/79 (2%) Frame = +3 Query: 408 PEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAMSHLPAXG-SSLDLI-NNLL 581 P + TL LS N ++ L + +AK LV+L LA NR+ E+ LDL NN L Sbjct: 439 PVLKTLYLSGNLLETLPDSMASAK-LVNLYLARNRLYEVPACVCELLTLEILDLSDNNRL 497 Query: 582 RDVPSDLGHLTSLEHLELE 638 +P +G LT + L L+ Sbjct: 498 TRLPEKMGKLTKISTLRLD 516 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +3 Query: 558 LDLINNLLRDVPSDLGHLTSLEHLELEGNPL 650 LDL N LR +PS L +T L++L+L N L Sbjct: 399 LDLQKNKLRKIPSGLLKMTCLKYLDLSDNEL 429 >SB_52308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 34.7 bits (76), Expect = 0.066 Identities = 30/94 (31%), Positives = 41/94 (43%), Gaps = 2/94 (2%) Frame = +3 Query: 375 LPNWIMSWIXLPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELA--MSHLPAX 548 +P I L + +L+LS NG L L L L L +N I+ L + +L Sbjct: 35 IPQCITQKPLLYTLQSLELSYNGFIELPPALGELVNLQELYLQHNSIELLPDELGNLVNL 94 Query: 549 GSSLDLINNLLRDVPSDLGHLTSLEHLELEGNPL 650 L L +N L DVP G LE L + GN + Sbjct: 95 -KRLGLAHNKLNDVPLYFGKFRQLEWLNISGNAI 127 >SB_46788| Best HMM Match : LRR_1 (HMM E-Value=9.1e-12) Length = 139 Score = 34.7 bits (76), Expect = 0.066 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 558 LDLINNLLRDVPSDLGHLTSLEHLELEGNPL 650 LDL NN +R +P GHLT L L L+ N + Sbjct: 25 LDLANNFIRTLPYSSGHLTRLRWLNLQNNQI 55 Score = 34.3 bits (75), Expect = 0.087 Identities = 28/83 (33%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = +3 Query: 405 LPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAMSHLPAXG-SSLDLINNLL 581 L ++ LDL+ N I+ L + +L LNL NN+I L S G L+L N L Sbjct: 19 LVQLEVLDLANNFIRTLPYSSGHLTRLRWLNLQNNQITNLPSSLADMNGLCYLNLEANEL 78 Query: 582 RDVPSDLGHLTSLEHLELEGNPL 650 + VP + L L+ L L N + Sbjct: 79 KIVPEVVTKLEKLQVLILSDNEI 101 >SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 825 Score = 34.7 bits (76), Expect = 0.066 Identities = 28/86 (32%), Positives = 37/86 (43%), Gaps = 4/86 (4%) Frame = +3 Query: 405 LPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNR---IKELAMSHLPAXGSSLDLINN 575 L + L LS N I + KL LNL NR I++ HL A L+L NN Sbjct: 108 LSSLEVLKLSKNRISTIRGAFWGQNKLQQLNLERNRLSHIQDTTFKHLLAL-KVLNLANN 166 Query: 576 LLRDV-PSDLGHLTSLEHLELEGNPL 650 + + L SLE L+L N + Sbjct: 167 RIYHISQGSFSDLRSLEGLDLSNNDI 192 >SB_35937| Best HMM Match : LRR_1 (HMM E-Value=7.1e-09) Length = 224 Score = 33.9 bits (74), Expect = 0.12 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 558 LDLINNLLRDVPSDLGHLTSLEHLELEGNPL 650 LDL N L +P+D+G L +L L LEGN L Sbjct: 57 LDLSYNRLSFIPADIGKLRALRELNLEGNQL 87 >SB_13921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 688 Score = 33.5 bits (73), Expect = 0.15 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 3/78 (3%) Frame = +3 Query: 420 TLDLSTNGIQNLNKFLHNAKKLVHLNLANN---RIKELAMSHLPAXGSSLDLINNLLRDV 590 TLDL+ + + + + + L L L N + E LP LDL NN + +V Sbjct: 21 TLDLNRKNLIEIPPKVLDLQHLEFLYLEGNYLTTLPETLFERLPNL-KWLDLRNNHINEV 79 Query: 591 PSDLGHLTSLEHLELEGN 644 P +LG L++L LEGN Sbjct: 80 PENLGAHRCLKNLLLEGN 97 >SB_10598| Best HMM Match : LRR_1 (HMM E-Value=4.4e-19) Length = 811 Score = 33.5 bits (73), Expect = 0.15 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 6/60 (10%) Frame = +3 Query: 483 LVHLNLANNRIKELAMSHLPAXGSSLDLINNL------LRDVPSDLGHLTSLEHLELEGN 644 LVHL+ + +L+++ LP L + L L+ +PSD+GHL +LE L+L N Sbjct: 74 LVHLSDIDLSSNDLSLNGLPNEFFQLPKLKQLYLNDCQLKTLPSDIGHLRTLEGLQLNDN 133 >SB_7548| Best HMM Match : LRR_1 (HMM E-Value=8.7e-14) Length = 384 Score = 33.5 bits (73), Expect = 0.15 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = +3 Query: 405 LPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAMSH-LPAXGSSLDLINNLL 581 LP + LDLS N I L L L + NN+++EL + A LDL +N L Sbjct: 83 LPHLVHLDLSYNRIGFLPDSFGYLFHLETLFINNNKLRELPDTFCYLARLQKLDLSHNQL 142 Query: 582 RDVPSDLGHLTSLEHLELEGNPL 650 +P ++G + SL + + N L Sbjct: 143 LHLPENIGLMESLLSINVSYNEL 165 >SB_13886| Best HMM Match : 7tm_1 (HMM E-Value=1e-08) Length = 536 Score = 33.5 bits (73), Expect = 0.15 Identities = 30/80 (37%), Positives = 41/80 (51%), Gaps = 5/80 (6%) Frame = +3 Query: 426 DLSTNGIQNLNK-FLHNAKKLVHLNLANNRIKELAMSHLPAXGSSLDLI----NNLLRDV 590 DLS GI + N LV LNL+ NRIK +S++ SL ++ NN L + Sbjct: 45 DLSDGGIDYIEPGTFRNYSNLVSLNLSMNRIKSFEVSNISTDLPSLAILDMTGNNWL--L 102 Query: 591 PSDLGHLTSLEHLELEGNPL 650 +D+ LTSL LE+ G L Sbjct: 103 SNDILLLTSL--LEIRGTKL 120 >SB_27801| Best HMM Match : LRR_1 (HMM E-Value=2.8e-15) Length = 318 Score = 32.7 bits (71), Expect = 0.27 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 4/86 (4%) Frame = +3 Query: 405 LPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKE----LAMSHLPAXGSSLDLIN 572 L E+ L L N I+ L + + K L L+L NN + E L + L LDL Sbjct: 160 LKELTYLSLHGNIIKELPLGIASMK-LSELHLVNNGLTEFHWGLCCNMLSLSLKVLDLRE 218 Query: 573 NLLRDVPSDLGHLTSLEHLELEGNPL 650 N ++ +PS + +L HL+L+ N L Sbjct: 219 NSIKSLPSVFCNFKNLVHLKLDDNGL 244 Score = 30.3 bits (65), Expect = 1.4 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 2/79 (2%) Frame = +3 Query: 414 IXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAMSHLPAXGS--SLDLINNLLRD 587 + LDL N I++L N K LVHL L +N + L + H+ S N LR Sbjct: 211 LKVLDLRENSIKSLPSVFCNFKNLVHLKLDDNGLHLLPI-HMGRMTSLRFFSASGNNLRV 269 Query: 588 VPSDLGHLTSLEHLELEGN 644 +P L L L+ +++ N Sbjct: 270 LPLSLSKL-RLDSVDVSNN 287 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = +3 Query: 423 LDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAMSHLPAXGSSLDLINNLLRD 587 L ++ ++ +++ + K+L +L+L N IKEL + S L L+NN L + Sbjct: 143 LSVTNCSMKCVDRRITKLKELTYLSLHGNIIKELPLGIASMKLSELHLVNNGLTE 197 >SB_10599| Best HMM Match : Tetraspannin (HMM E-Value=1.8e-10) Length = 691 Score = 32.7 bits (71), Expect = 0.27 Identities = 31/97 (31%), Positives = 43/97 (44%), Gaps = 16/97 (16%) Frame = +3 Query: 408 PEIXTLDLSTN-----GIQNLNKFLHNAKKLVHLNLANNRIKE---LAMSHLPAXGSSLD 563 P + TLDLS N G + + K L+ KL LNL +N+I+ A+ H + L Sbjct: 279 PSLITLDLSHNKIGDSGARAIGKLLNGRCKLTILNLCDNKIRSNGAAAIGHALGKNTILK 338 Query: 564 LINNLLRDVPSDLGHL--------TSLEHLELEGNPL 650 IN L + D G +L H+ L GN L Sbjct: 339 NINIRLNRLGDDGGQAICRALLKNETLTHVHLGGNDL 375 >SB_38600| Best HMM Match : Ank (HMM E-Value=6.9e-36) Length = 852 Score = 32.3 bits (70), Expect = 0.35 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = +3 Query: 423 LDLSTNGIQNLNKFLHN-AKKLVHLNLANNRIKEL-AMSHLPAXGSSLDLINNLLRD 587 LDLS N I ++ + A L LNL+ N I E+ ++ P+ SSLDL NN L + Sbjct: 626 LDLSNNRITSVPVGMPCLATSLQTLNLSGNNISEVKTLAQFPSSLSSLDLSNNRLSE 682 >SB_33107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1079 Score = 32.3 bits (70), Expect = 0.35 Identities = 20/50 (40%), Positives = 30/50 (60%) Frame = +3 Query: 483 LVHLNLANNRIKELAMSHLPAXGSSLDLINNLLRDVPSDLGHLTSLEHLE 632 L L L NNRI +A + L +++L NNLL +VPS + H +L +L+ Sbjct: 118 LTFLMLQNNRIPYIAPNVLSWRILTVELTNNLLTEVPSGM-HPVNLHNLK 166 >SB_14995| Best HMM Match : LRR_1 (HMM E-Value=4e-13) Length = 188 Score = 32.3 bits (70), Expect = 0.35 Identities = 21/76 (27%), Positives = 39/76 (51%), Gaps = 2/76 (2%) Frame = +3 Query: 429 LSTNGIQNLNKFLHNAKKLVHLNLANNRIKEL--AMSHLPAXGSSLDLINNLLRDVPSDL 602 L N +++L + L N + L L L++N + L +S+L LD N + D+P + Sbjct: 88 LDANQLRDLPRGLFNLQNLQVLGLSDNELTILPSVLSNLVNL-RILDFSKNGIIDIPETI 146 Query: 603 GHLTSLEHLELEGNPL 650 H +L+ ++ NP+ Sbjct: 147 KHCKNLQEIDASVNPI 162 >SB_28720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 672 Score = 31.9 bits (69), Expect = 0.47 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +3 Query: 480 KLVHLNLANNRIKELAMSHLPAXGSS-LDLINNLLRDVPSDLGHLTSLEHLELEGNPL 650 KL LN+ NR++ L + S L L +NLL+ +P+++G+ +L L++ GN L Sbjct: 6 KLSLLNVDRNRLEVLPVELGSCTKLSVLSLRDNLLQRLPTEIGNCRNLHVLDVSGNRL 63 >SB_9680| Best HMM Match : Ank (HMM E-Value=4e-20) Length = 1243 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = +3 Query: 396 WIXLPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAM 530 W+ + L ++ N +++L + +A LV L L+NN++KE M Sbjct: 440 WMRCTSLKVLKVTHNLLESLPFGIQSASSLVKLFLSNNKLKEFPM 484 >SB_45368| Best HMM Match : fn2 (HMM E-Value=3.1e-32) Length = 1206 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = -2 Query: 625 CSKLVKCPRSEGTSLKRLLIKSNELPLAGKCDMASSFILLFAKFKCTN 482 C C + G+ +R+L+K EL K +F L+F+ + TN Sbjct: 960 CPSSCSCVYTSGSGPRRILVKGQELTAIPKTMPLDTFALMFSSNRITN 1007 >SB_38674| Best HMM Match : TIR (HMM E-Value=2.5e-31) Length = 870 Score = 30.7 bits (66), Expect = 1.1 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 2/69 (2%) Frame = +3 Query: 423 LDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAMSHLPAXGSSLDL-IN-NLLRDVPS 596 ++L N I+ L + H + L L+NN IKEL M+ + + ++L IN N L+ +P Sbjct: 522 VNLRGNAIREL-PWRHYLGNITVLELSNNEIKELNMTFVDSLARVVNLAINDNKLKYLPR 580 Query: 597 DLGHLTSLE 623 + +LT+ E Sbjct: 581 GVTNLTARE 589 >SB_6475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +3 Query: 405 LPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKEL 524 L I +LDLS GIQ+L+ + L++LNL++N I L Sbjct: 11 LGSIHSLDLSNMGIQDLS-IVGQCTGLLYLNLSSNNITSL 49 >SB_5807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 250 Score = 29.9 bits (64), Expect = 1.9 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +3 Query: 423 LDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAMSH-LPAXGSSLDLINNLLRDVPSD 599 LD+S+NG+ ++ + KL+ NN + EL A L+L N L Sbjct: 67 LDVSSNGLAYISARISELDKLLTFIGRNNNLDELPKEFGSLAKLEKLNLSGNRLESFGPS 126 Query: 600 LGHLTSLEHLELEGNPL 650 + LT L+ L L GN + Sbjct: 127 IFRLTQLKVLLLGGNKI 143 >SB_51944| Best HMM Match : LRR_1 (HMM E-Value=7.7e-34) Length = 409 Score = 29.9 bits (64), Expect = 1.9 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 5/87 (5%) Frame = +3 Query: 405 LPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAMSHLPAXGS-----SLDLI 569 L + TL S N ++ + + + L L+L+ N+I L + G LD+ Sbjct: 287 LKNLKTLFFSANNLEIVPESICKLP-LRELDLSINKISSLPDFVRASIGDMSTLVELDIS 345 Query: 570 NNLLRDVPSDLGHLTSLEHLELEGNPL 650 +N + +P +G + LE L E NPL Sbjct: 346 SNKITALPKSIGKMERLEILRAESNPL 372 >SB_5894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 379 Score = 29.9 bits (64), Expect = 1.9 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 2/79 (2%) Frame = +3 Query: 375 LPNWIMSWIXLPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAMSHLPAXGS 554 LP SWI L E L+++TN I L + + L L L+NN +K+L + A Sbjct: 292 LPLDFGSWISLVE---LNVATNQISKLPEDIQWLVNLEVLILSNNLLKKLPRG-IGALRK 347 Query: 555 --SLDLINNLLRDVPSDLG 605 LD+ N L +P+++G Sbjct: 348 LRVLDIEENKLESIPTEIG 366 >SB_45576| Best HMM Match : LRR_1 (HMM E-Value=2.7e-14) Length = 829 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 405 LPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRI 515 L + LDL+ N + ++ + N KL +LNL NN I Sbjct: 544 LESLEKLDLNNNKLTSIPAGITNLTKLTNLNLENNNI 580 >SB_13883| Best HMM Match : 7tm_1 (HMM E-Value=6e-08) Length = 535 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +3 Query: 414 IXTLDLSTNGIQNL-NKFLHNAKKLVHLNLANNRIKE 521 + L L+ N ++ + N L K L++LNLANN++++ Sbjct: 52 VKNLTLADNDLEEIGNASLSGLKSLLYLNLANNKLRK 88 >SB_13884| Best HMM Match : LRR_1 (HMM E-Value=6.3e-06) Length = 575 Score = 29.1 bits (62), Expect = 3.3 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Frame = +3 Query: 483 LVHLNLANNRIKELAMSHLPAXGS--SLDLINNLLRDVPSDLGH-LTSLEHLELEGNPL 650 L++L L NN I +A + SL+L +N + ++ L SLE LEL+GNP+ Sbjct: 130 LINLTLENNSISAIAPHAFKGLDNLQSLNLRHNNISLWEGNISRDLPSLEILELDGNPV 188 >SB_15974| Best HMM Match : LRR_1 (HMM E-Value=7.1e-15) Length = 272 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 405 LPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANN 509 L + TLD+ N +Q+L + N K L LN++NN Sbjct: 109 LSSLQTLDVQGNNLQSLPLEIGNLKLLRSLNVSNN 143 >SB_13209| Best HMM Match : LRR_1 (HMM E-Value=1.7e-13) Length = 489 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 426 DLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAMS 533 DLS G + K L + K L L+LANN I++ +S Sbjct: 146 DLSAKGSVYMGKVLVSNKSLKELDLANNNIRKEGVS 181 >SB_20569| Best HMM Match : LRR_1 (HMM E-Value=1.1e-27) Length = 309 Score = 28.7 bits (61), Expect = 4.3 Identities = 25/76 (32%), Positives = 32/76 (42%), Gaps = 2/76 (2%) Frame = +3 Query: 423 LDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAMSH--LPAXGSSLDLINNLLRDVPS 596 L N I +L + L L+L N + L LP + LDL N + P Sbjct: 165 LSAGKNMITSLPDKISGLVSLQWLSLRENHLSSLPSEFFKLPKL-AHLDLNMNKFEEFPE 223 Query: 597 DLGHLTSLEHLELEGN 644 +L L SLE L L GN Sbjct: 224 NLIGLVSLECLSLRGN 239 >SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37) Length = 1655 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +3 Query: 468 HNAKKLVHLNLANNRIKELAMSHLPAXGSSLDLINNLLRDVPSD-LGHLTSLEHLE 632 H +K LV L +++ S LP + +DL NLL+ +P D LT L LE Sbjct: 804 HGSKSLV-LTASHHHTITTFPSSLPQTSTIIDLSENLLKVLPPDQFSALTDLTTLE 858 >SB_5195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = -2 Query: 613 VKCPRSEGTSLKRLLIKSNELPLAGKCDMASSFILLFAKFKCTNFFALC 467 V CP +EG S +KS L GK D + F+L + F LC Sbjct: 290 VLCPYTEGFSTMPETLKSLFSILLGKLDYNNDFVLTSDFQRLVQLFLLC 338 >SB_31796| Best HMM Match : SAP (HMM E-Value=3.5e-10) Length = 1029 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/66 (30%), Positives = 30/66 (45%) Frame = +3 Query: 381 NWIMSWIXLPEIXTLDLSTNGIQNLNKFLHNAKKLVHLNLANNRIKELAMSHLPAXGSSL 560 N+ ++ LP I + + N N N K+ + + + R KEL + LP GS Sbjct: 326 NYPCQFVGLPSIPE-NSTKNTTSNNNNNEEKPVKIEDMRVVDMR-KELKLRGLPVSGSKT 383 Query: 561 DLINNL 578 DLI L Sbjct: 384 DLIERL 389 >SB_19790| Best HMM Match : LRR_1 (HMM E-Value=0.00028) Length = 74 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 558 LDLINNLLRDVPSDLGHLTSLEHLELEGNPL 650 LD+ +N + +P +G + LE L E NPL Sbjct: 7 LDISSNKITALPKSIGKMERLEILRAESNPL 37 >SB_29271| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 796 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 383 IW*YCGGKDLKYXCYGALAKGELIKFGEVTAR 288 +W Y GG+D+ + L+ G+L K GEV +R Sbjct: 159 VWKYAGGRDVTH-----LSSGQLYKAGEVISR 185 >SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) Length = 707 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +1 Query: 214 WLPAXQPSVPKAAFAVLLAMAYIVPRAVTSPNFISSPFAKAP*HXYFRSFP 366 WL +P++ +L+ + Y P AVT N I + + RS P Sbjct: 190 WLHVKPYRLPRSVSTILIGVIYHPPHAVTEDNSILYSHVQETVDCFLRSHP 240 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,137,484 Number of Sequences: 59808 Number of extensions: 369457 Number of successful extensions: 853 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 776 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 846 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -