BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2025 (600 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03700.1 68418.m00330 PAN domain-containing protein contains ... 29 3.1 At5g15580.1 68418.m01824 expressed protein unknown protein F14P3... 27 7.2 >At5g03700.1 68418.m00330 PAN domain-containing protein contains Pfam profile: PF00024 PAN domain Length = 482 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +2 Query: 134 DSCIDXCSYWCNIYIDXKSCCYL-----RIGFGFFTPEPLNYFKI 253 + C+D C + +Y + CYL R G P L YFK+ Sbjct: 365 EMCVDNCKCFGAVYNNGSGFCYLVNYPIRTMLGVADPSKLGYFKV 409 >At5g15580.1 68418.m01824 expressed protein unknown protein F14P3.18 - Arabidopsis thaliana, EMBL:AC009755 Length = 927 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 81 LYNFGDRTPNIKLFVGLNLGIFFTFF 4 LYN D PN+ +G GIF F+ Sbjct: 6 LYNLSDENPNLNKQIGCMNGIFQVFY 31 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,052,186 Number of Sequences: 28952 Number of extensions: 135487 Number of successful extensions: 184 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 184 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -