BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2021 (600 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-2324|AAF55395.1| 272|Drosophila melanogaster CG5246-PA... 28 8.4 AE014296-450|AAF47642.2| 1932|Drosophila melanogaster CG13800-PA... 28 8.4 >AE014297-2324|AAF55395.1| 272|Drosophila melanogaster CG5246-PA protein. Length = 272 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 174 ISITVGISDCAAKSVLIVKLYMCPTHLIHVQ 266 IS+ V +S C+AKSV I + + HL HV+ Sbjct: 7 ISVLVILSQCSAKSVKIHRRHQLNHHLGHVK 37 >AE014296-450|AAF47642.2| 1932|Drosophila melanogaster CG13800-PA protein. Length = 1932 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 376 RGGTC*QLPERLRRK--PNSSRAPALRMNLLPDRSRD 480 +GG QLPERL ++ P ++ PA R +L P+ D Sbjct: 886 QGGAIAQLPERLSKEEIPKAAPVPAPRKSLTPEPMLD 922 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,723,710 Number of Sequences: 53049 Number of extensions: 474827 Number of successful extensions: 1012 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1012 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2441585082 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -