SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-2021
         (600 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat...    25   0.57 
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    23   3.0  

>AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 1040

 Score = 25.0 bits (52), Expect = 0.57
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +1

Query: 223 LLNYICVL-PT*YMCKTQHSSKGFFFMIEVLLVARRPFQFHQYRWASKGSAKR 378
           L+ +  VL PT  +C  Q  + GF F +    +  +  +  +   ASK SAKR
Sbjct: 707 LVTFALVLRPTDIVCGIQRFAAGFCFTVVYAALLTKTNRISRIFNASKHSAKR 759


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 22.6 bits (46), Expect = 3.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -3

Query: 574  GNRIXRTCQK 545
            GN+I RTCQK
Sbjct: 1317 GNKILRTCQK 1326


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 146,181
Number of Sequences: 438
Number of extensions: 2798
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17604432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -