BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2019 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 1.9 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 7.8 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/58 (17%), Positives = 24/58 (41%) Frame = +1 Query: 370 RRPQNDMSLESFIRAKYEQKKYIAKEWVPPQLPKVNWDKEIDEEMDRQKRKKKSATSS 543 ++PQ + + + +Q++ + W + P +W D +D + + SS Sbjct: 438 QQPQQQQQQQQQQQQQQQQQQQQQQHWPMEEEPAASWGSASDVTLDEAVKSPLGSVSS 495 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 229 HRNLGVHISKVKSVNLDSWTPEQVVSLQQ 315 ++N+GV +S SV L P Q + QQ Sbjct: 1211 NKNVGVGVSNSGSVVLGKQQPSQQQTQQQ 1239 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,426 Number of Sequences: 438 Number of extensions: 3772 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -