BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-2017 (450 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29012| Best HMM Match : Avirulence (HMM E-Value=1.1) 32 0.25 SB_37790| Best HMM Match : HAT (HMM E-Value=0.17) 28 3.1 SB_5142| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_5689| Best HMM Match : Ribosomal_L34e (HMM E-Value=0.34) 27 5.4 SB_30084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_3589| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_29012| Best HMM Match : Avirulence (HMM E-Value=1.1) Length = 444 Score = 31.9 bits (69), Expect = 0.25 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 91 RTLRSVETHPGPLLSEGRLHKKH*SHCVARAALVIRRV 204 +T+R V+T P L + RLH H +HC L +R V Sbjct: 370 QTVRIVQTPPDRLCALYRLHHTHSAHCTDTTRLTVRTV 407 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 91 RTLRSVETHPGPLLSEGRLHKKH*SHCVARAALVIRRV 204 +TLR V+T P L + R H+ H +HC +R V Sbjct: 210 QTLRIVQTPPDRLCALYRFHQTHCAHCTDFTRQTVRTV 247 >SB_37790| Best HMM Match : HAT (HMM E-Value=0.17) Length = 498 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 71 LNIDISNAHCGPWRHIQDHSCLRAGCIKN 157 L +D+ NA GPW I+ H C + C+ N Sbjct: 287 LKLDMGNA--GPWGDIKIHPCDKPKCLTN 313 >SB_5142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 27.9 bits (59), Expect = 4.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 104 PWRHIQDHSCLRAGCIKNI 160 PWR+ DH CL+ I N+ Sbjct: 5 PWRNAADHHCLKTAIIFNV 23 >SB_5689| Best HMM Match : Ribosomal_L34e (HMM E-Value=0.34) Length = 524 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 91 RTLRSVETHPGPLLSEGRLHKKH*SHCVARAALVIRRV 204 +T+R+V+T P L + R H+ +HC +R V Sbjct: 365 QTVRTVQTSPDRLCALYRFHQTDCAHCTVTTRQTVRSV 402 >SB_30084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.1 bits (57), Expect = 7.2 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +2 Query: 269 PKTTITNRVSLARLSDGSKNVLLXFQNFHNHVEPLWRARYV*RAR 403 P + + N L DG ++ + N VEPLW +V A+ Sbjct: 17 PNSPVQNGTLKQSLEDGKDHMSTCYDWSRNEVEPLWLYEHVEAAK 61 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 26.6 bits (56), Expect = 9.5 Identities = 19/68 (27%), Positives = 28/68 (41%) Frame = -3 Query: 205 QRDGSRARHEPRNVINVFYAAGPQTGVVLDVSPRTAMCVRNVDVQMCPAVHXXXXXXXXX 26 Q G R E R + F QT ++L P++A+CV+ D + A+H Sbjct: 156 QSSGMRRLEEERVL---FLETDTQTDMLLG-KPKSAICVQRFDDSLNSAIHTTYRTWLRS 211 Query: 25 XXXREPSD 2 EP D Sbjct: 212 SSMHEPRD 219 >SB_3589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 26.6 bits (56), Expect = 9.5 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +1 Query: 64 DTFEHRHFER-TLRSVETHPGPLLSEGRLHKKH*SHCVARAALVIRRVDAFRVT 222 D+ + F R T +V+T P + RLH+ +HC ++R V R T Sbjct: 64 DSAHYTDFTRQTAHTVQTSPDRQRTLYRLHQTDSAHCTDFTKQIVRTVQTTRQT 117 >SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 26.6 bits (56), Expect = 9.5 Identities = 19/68 (27%), Positives = 28/68 (41%) Frame = -3 Query: 205 QRDGSRARHEPRNVINVFYAAGPQTGVVLDVSPRTAMCVRNVDVQMCPAVHXXXXXXXXX 26 Q G R E R + F QT ++L P++A+CV+ D + A+H Sbjct: 65 QSSGMRRLEEERVL---FLETDTQTDMLLG-KPKSAICVQRFDDSLNSAIHTTYRTWLRS 120 Query: 25 XXXREPSD 2 EP D Sbjct: 121 SSMHEPRD 128 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,441,914 Number of Sequences: 59808 Number of extensions: 225251 Number of successful extensions: 634 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 634 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -