BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1340 (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 26 1.0 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 26 1.4 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 26 1.4 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 7.4 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 26.2 bits (55), Expect = 1.0 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -3 Query: 209 NVVVPKILSKSL*NFVNTVKNSNKIRIYLGITILYSIINFCN 84 N++VP +L S+ T+ + ++ LG+TIL S+ F N Sbjct: 237 NLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLN 278 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 25.8 bits (54), Expect = 1.4 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -3 Query: 209 NVVVPKILSKSL*NFVNTVKNSNKIRIYLGITILYSIINFCN 84 N++VP +L S+ T+ + ++ LG+TIL S+ F N Sbjct: 220 NLIVPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLN 261 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 25.8 bits (54), Expect = 1.4 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -3 Query: 209 NVVVPKILSKSL*NFVNTVKNSNKIRIYLGITILYSIINFCN 84 N++VP +L S+ T+ + ++ LG+TIL S+ F N Sbjct: 252 NLIVPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLN 293 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 7.4 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = -2 Query: 492 RIYR*SI*SNQNKLYCVIEITLYLCNYLN 406 + Y+ SI ++L C++E+ L N+L+ Sbjct: 1085 KTYQGSIIQKYSRLSCILELDTMLANHLH 1113 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 601,232 Number of Sequences: 2352 Number of extensions: 10774 Number of successful extensions: 20 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -