Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-1336
         (690 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292352-1|CAL23164.1|  250|Tribolium castaneum gustatory recept...    29   0.036
EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetyla...    21   7.2  

>AM292352-1|CAL23164.1|  250|Tribolium castaneum gustatory receptor
           candidate 31 protein.
          Length = 250

 Score = 29.1 bits (62), Expect = 0.036
 Identities = 12/30 (40%), Positives = 22/30 (73%)
 Frame = -3

Query: 301 VINIMYCGAHLGTISTTVMPISTSLSSSNY 212
           +I++  CGA + + S+ V+P+  S+SSS+Y
Sbjct: 208 LISVCLCGASVHSESSKVLPLLFSVSSSSY 237


>EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetylase
           1 protein.
          Length = 534

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 384 ESTITIQLNNPP 419
           +STIT  L+NPP
Sbjct: 324 DSTITAPLSNPP 335


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 144,824
Number of Sequences: 336
Number of extensions: 2893
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18114270
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)