BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1336 (690 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 27 0.74 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 24 3.9 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 23 9.1 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 26.6 bits (56), Expect = 0.74 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 356 IYRNCLKKTRKHNNDSTKQ 412 +Y NCLKK +HNN Q Sbjct: 702 MYENCLKKFYRHNNVEVMQ 720 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 24.2 bits (50), Expect = 3.9 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +2 Query: 80 DLPSLETHRCHSVNTVTHV---DK*IAIAWLN 166 +LP LE C+SV V +V DK + I LN Sbjct: 270 ELPGLEHEACNSVYAVANVTLSDKQLCIGGLN 301 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 23.0 bits (47), Expect = 9.1 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +2 Query: 53 YIASIIK-VHDLPSLETHRC 109 Y II+ VHDL SL TH C Sbjct: 236 YHKQIIQYVHDLNSLVTHLC 255 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 641,508 Number of Sequences: 2352 Number of extensions: 12369 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -