BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1335 (369 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY101765-1|AAM50084.1| 1885|Homo sapiens C3 and PZP-like alpha-2... 66 3e-11 AB033109-1|BAA86597.1| 1884|Homo sapiens KIAA1283 protein protein. 66 3e-11 AJ404468-1|CAB94756.1| 4486|Homo sapiens axonemal dynein heavy c... 30 2.0 AF257737-1|AAF69004.1| 4486|Homo sapiens ciliary dynein heavy ch... 30 2.0 >AY101765-1|AAM50084.1| 1885|Homo sapiens C3 and PZP-like alpha-2-macroglobulin domain containing 8 protein. Length = 1885 Score = 66.5 bits (155), Expect = 3e-11 Identities = 33/102 (32%), Positives = 55/102 (53%), Gaps = 2/102 (1%) Frame = +1 Query: 70 VATDDNLQYQFF--PVSSGSVQFKVRAANDAHVALTTGPQESDPMYEVMIGGWGNAKSVI 243 ++T + ++Q+ P+ VRA NDA VAL++GPQ++ M E+++GG N +S I Sbjct: 953 ISTPNKYEFQYVQRPLRLTRFDVAVRAHNDARVALSSGPQDTAGMIEIVLGGHQNTRSWI 1012 Query: 244 RKNRTKPDKVEIESPGILNGGEYRGFWVRWDSGIISAGREGE 369 ++ + IL+ E+R FW+ W G+I G E Sbjct: 1013 STSKMGEPVASAHTAKILSWDEFRTFWISWRGGLIQVGHGPE 1054 >AB033109-1|BAA86597.1| 1884|Homo sapiens KIAA1283 protein protein. Length = 1884 Score = 66.5 bits (155), Expect = 3e-11 Identities = 33/102 (32%), Positives = 55/102 (53%), Gaps = 2/102 (1%) Frame = +1 Query: 70 VATDDNLQYQFF--PVSSGSVQFKVRAANDAHVALTTGPQESDPMYEVMIGGWGNAKSVI 243 ++T + ++Q+ P+ VRA NDA VAL++GPQ++ M E+++GG N +S I Sbjct: 952 ISTPNKYEFQYVQRPLRLTRFDVAVRAHNDARVALSSGPQDTAGMIEIVLGGHQNTRSWI 1011 Query: 244 RKNRTKPDKVEIESPGILNGGEYRGFWVRWDSGIISAGREGE 369 ++ + IL+ E+R FW+ W G+I G E Sbjct: 1012 STSKMGEPVASAHTAKILSWDEFRTFWISWRGGLIQVGHGPE 1053 >AJ404468-1|CAB94756.1| 4486|Homo sapiens axonemal dynein heavy chain 9 protein. Length = 4486 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = -2 Query: 290 PGLSISTLSGLV----LFFLMTLLAFPQPPIITSYIGSDSCGPVVSATWASFAAL 138 PGL + SGL LFFL T P+PP S+ G+ CG + +A AAL Sbjct: 85 PGLEVGPESGLAGAKALFFLRT---GPEPPGPDSFRGAVVCGDLPAAPLEHLAAL 136 >AF257737-1|AAF69004.1| 4486|Homo sapiens ciliary dynein heavy chain 9 protein. Length = 4486 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = -2 Query: 290 PGLSISTLSGLV----LFFLMTLLAFPQPPIITSYIGSDSCGPVVSATWASFAAL 138 PGL + SGL LFFL T P+PP S+ G+ CG + +A AAL Sbjct: 85 PGLEVGPESGLAGAKALFFLRT---GPEPPGPDSFRGAVVCGDLPAAPLEHLAAL 136 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 49,038,466 Number of Sequences: 237096 Number of extensions: 979961 Number of successful extensions: 2385 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2385 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2363825726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -