BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1333 (717 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 24 1.4 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 22 4.3 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 4.3 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 5.7 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 5.7 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 23.8 bits (49), Expect = 1.4 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 51 YRCKSCAKAFNKVDQIR 1 Y C C KAF + D +R Sbjct: 108 YSCDICGKAFRRQDHLR 124 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 22.2 bits (45), Expect = 4.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 51 YRCKSCAKAFN 19 YRC+ C KAF+ Sbjct: 78 YRCRLCKKAFS 88 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 4.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 51 YRCKSCAKAFN 19 YRC+ C KAF+ Sbjct: 334 YRCRLCKKAFS 344 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -1 Query: 330 LLCDPTVILLYRTFICFGEYIFHIYLLFCL 241 +L V LL+ F C+ HIY L L Sbjct: 7 VLTAAAVFLLFYLFYCYKTIKQHIYSLISL 36 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -1 Query: 330 LLCDPTVILLYRTFICFGEYIFHIYLLFCL 241 +L V LL+ F C+ HIY L L Sbjct: 7 VLTAAAVFLLFYLFYCYKTIKQHIYSLISL 36 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,615 Number of Sequences: 336 Number of extensions: 3224 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -