BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1332 (642 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0378 - 28438918-28439064,28439280-28439313,28439859-284399... 28 7.2 08_01_0344 + 3043824-3044123,3044260-3044314,3044810-3044985,304... 27 9.6 >02_05_0378 - 28438918-28439064,28439280-28439313,28439859-28439963, 28440402-28441558 Length = 480 Score = 27.9 bits (59), Expect = 7.2 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -2 Query: 128 VGARVVYDVGDGGSVTTTPRQSLVC*SAGCAASRRGWLWLRR 3 V A + VGD R+SL+ + A RRG WLRR Sbjct: 436 VVAEIGERVGDPRGTGLQERRSLMAVGSWIGAKRRGGYWLRR 477 >08_01_0344 + 3043824-3044123,3044260-3044314,3044810-3044985, 3045083-3045283,3045383-3045642,3045909-3046222, 3046399-3046622,3047046-3047398,3047709-3047826, 3047875-3048133,3048252-3049729 Length = 1245 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 639 GLFEILRNGIGFLTYRVLS 583 G FE +NG+GFLT R++S Sbjct: 761 GWFEKPKNGVGFLTSRIVS 779 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,133,749 Number of Sequences: 37544 Number of extensions: 272641 Number of successful extensions: 542 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 542 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -