BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1331 (640 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016414-5|AAG24020.1| 585|Caenorhabditis elegans Hypothetical ... 29 2.8 AL023838-4|CAA19504.1| 218|Caenorhabditis elegans Hypothetical ... 29 3.7 >AF016414-5|AAG24020.1| 585|Caenorhabditis elegans Hypothetical protein D1065.1 protein. Length = 585 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 318 WRESQVKLNYYIF-FTNYLIILFYFTNHYIF 407 WR ++ L Y IF YL + YFT Y+F Sbjct: 77 WRSQEMWLEYSIFGVLMYLFAILYFTYFYLF 107 >AL023838-4|CAA19504.1| 218|Caenorhabditis elegans Hypothetical protein Y43C5A.4 protein. Length = 218 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 23 APLPQTEASPPVIDEEEWNPPPQKKR 100 +P P A P + E+EW PPP+ +R Sbjct: 162 SPAPPVPAVPAAV-EQEWKPPPEFER 186 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,950,230 Number of Sequences: 27780 Number of extensions: 209989 Number of successful extensions: 673 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 671 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -