BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1330 (644 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|c... 28 1.0 SPAC2F7.16c |||phospholipase D |Schizosaccharomyces pombe|chr 1|... 27 2.3 SPAC25A8.01c ||snf2SR|fun thirty related protein Fft3|Schizosacc... 26 4.0 SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosa... 25 7.1 SPAC17G6.10 |ssr1||SWI/SNF and RSC complex subunit Ssr1|Schizosa... 25 9.3 SPCC338.11c |rrg1|uvi22|methyltransferase |Schizosaccharomyces p... 25 9.3 SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosa... 25 9.3 >SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 625 Score = 28.3 bits (60), Expect = 1.0 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +1 Query: 193 NIINEVFQKKEVEQKRFLP-SIKNYKVLGETRPSSFGPATYQDFKD 327 NI+ V K ++EQK LP ++KN + G+ SS A ++++ D Sbjct: 204 NIVGRVADKLQLEQKSVLPNAVKN--IDGQDDDSSEQTAAFEEYDD 247 >SPAC2F7.16c |||phospholipase D |Schizosaccharomyces pombe|chr 1|||Manual Length = 1369 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 520 DCWLLAAVANLTLYRKLFFQVVPDDQ 597 D W A N T+YR + F+ VPDD+ Sbjct: 1220 DIWSKVASNNTTIYRHI-FRCVPDDE 1244 >SPAC25A8.01c ||snf2SR|fun thirty related protein Fft3|Schizosaccharomyces pombe|chr 1|||Manual Length = 922 Score = 26.2 bits (55), Expect = 4.0 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = -3 Query: 642 PETEMEDARIIFIETLIIRYNLEE*LAIKCQVGNGSQQPTIAQLSLL 502 P+ +++D +II I L + Y L+ + ++G G TIA SLL Sbjct: 383 PDIKLQDYQIIGINWLYLLYELKLAGILADEMGLGKTCQTIAFFSLL 429 >SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosaccharomyces pombe|chr 2|||Manual Length = 548 Score = 25.4 bits (53), Expect = 7.1 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 428 SLGSDLGKSATTLNFSSKATVASTSNKE 511 SL S+LGK+ T + SKA V ++++ E Sbjct: 473 SLSSNLGKTNPTSVYQSKANVTTSADVE 500 >SPAC17G6.10 |ssr1||SWI/SNF and RSC complex subunit Ssr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 527 Score = 25.0 bits (52), Expect = 9.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 259 NYKVLGETRPSSFGPATYQDFK 324 NY V +TRPS GP + F+ Sbjct: 139 NYNVNPDTRPSKIGPPSTSHFQ 160 >SPCC338.11c |rrg1|uvi22|methyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 303 Score = 25.0 bits (52), Expect = 9.3 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -2 Query: 616 HNLHRNSDH-QVQLGRITCDKVSSWQRQPTANNRPTLLV 503 +N+ NS+ Q G ++C V W P +NRP+ L+ Sbjct: 175 YNVDYNSELIQQYAGSVSCH-VLDWMNPPDDDNRPSWLI 212 >SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosaccharomyces pombe|chr 3|||Manual Length = 877 Score = 25.0 bits (52), Expect = 9.3 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -2 Query: 631 NGRRPHNLHRNSDHQVQLGRITCDKVSSWQRQPTANNRPTL 509 NG + R + +G+ D+V W P NRPT+ Sbjct: 791 NGSSLTSSSRETPANSIIGQGGLDRVVEWMLSPEPRNRPTI 831 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,758,991 Number of Sequences: 5004 Number of extensions: 57854 Number of successful extensions: 136 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -