BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1330 (644 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeo... 24 3.6 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 23 8.3 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 23 8.3 >AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeotic protein protein. Length = 324 Score = 24.2 bits (50), Expect = 3.6 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 370 PEFPAVDRSLYYKESLD 420 P FP DR YY++++D Sbjct: 60 PRFPPYDRMGYYQQTMD 76 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.0 bits (47), Expect = 8.3 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -2 Query: 619 PHNLHRNSDHQVQLGRITCDKVSSWQRQPTAN 524 PH H+ HQ Q VS+ Q + AN Sbjct: 77 PHQYHQQVQHQPQPPSTPFANVSTGQNESLAN 108 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.0 bits (47), Expect = 8.3 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -2 Query: 619 PHNLHRNSDHQVQLGRITCDKVSSWQRQPTAN 524 PH H+ HQ Q VS+ Q + AN Sbjct: 78 PHQYHQQVQHQPQPPSTPFANVSTGQNESLAN 109 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 707,693 Number of Sequences: 2352 Number of extensions: 14644 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63559560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -