BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1329 (476 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 9.0 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 9.0 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 20.6 bits (41), Expect = 9.0 Identities = 11/45 (24%), Positives = 23/45 (51%) Frame = +3 Query: 243 LGVDFILIVIICVNVSPKYGSDTLINLGYCLRSLVSTFLQRTPAI 377 LG+ +L +++ + + K T + L + L+ TF+ T +I Sbjct: 267 LGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSI 311 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 20.6 bits (41), Expect = 9.0 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +2 Query: 254 FYSNRHYMCKCISKIRQRYI 313 + SN +CKC ++ +RY+ Sbjct: 663 YSSNNKTLCKCDAQNCRRYL 682 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,887 Number of Sequences: 438 Number of extensions: 2512 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12928545 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -