BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1328 (722 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0837 - 20925345-20926178 29 3.7 06_01_0558 - 3968211-3969475,3970198-3970266,3970374-3970529,397... 29 4.9 04_04_0308 + 24286923-24286927,24288430-24288907,24288980-242890... 29 4.9 >10_08_0837 - 20925345-20926178 Length = 277 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 484 HCYFLINMKNNRISGKTSTMLFSTTVSLVDSDLYQLILYY 603 H Y+L ++K G + + FSTTV L D L++ Y Sbjct: 38 HHYYLFSIKQLNSFGAAAVLAFSTTVPLSDIAFALLVIPY 77 >06_01_0558 - 3968211-3969475,3970198-3970266,3970374-3970529, 3971075-3971405 Length = 606 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 466 SKLNQQHCYFLINMKNNRISGKTSTMLFSTTVSL 567 S L+ QH +LI++ NN +SG T L + L Sbjct: 313 SFLSHQHGLYLIDVSNNNLSGHFPTWLLENNIYL 346 >04_04_0308 + 24286923-24286927,24288430-24288907,24288980-24289099, 24289182-24289235,24289467-24289579,24289799-24290011, 24290123-24290201,24290323-24290376,24290448-24290522, 24291029-24291193,24291843-24291941,24292186-24292241, 24292331-24292433,24293289-24293417,24293657-24293835, 24293953-24293977,24294060-24294175,24294252-24294342 Length = 717 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 308 IVYCKWNSGTSSRDAYYCSNNIINK 234 IVYCK+ + T Y C NNI K Sbjct: 348 IVYCKFQAETDFVSKYLCDNNITAK 372 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,357,940 Number of Sequences: 37544 Number of extensions: 311991 Number of successful extensions: 719 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -